KEGG   Kineococcus radiotolerans: Krad_1200Help
Entry
Krad_1200         CDS       T00562                                 

Definition
(GenBank) Glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
kra  Kineococcus radiotolerans
Pathway
kra00030  Pentose phosphate pathway
kra00480  Glutathione metabolism
kra01100  Metabolic pathways
kra01110  Biosynthesis of secondary metabolites
kra01120  Microbial metabolism in diverse environments
kra01130  Biosynthesis of antibiotics
kra01200  Carbon metabolism
Module
kra_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
kra_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:kra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Krad_1200
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Krad_1200
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kra04147]
    Krad_1200
Enzymes [BR:kra01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     Krad_1200
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     Krad_1200
Exosome [BR:kra04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Krad_1200
  Exosomal proteins of colorectal cancer cells
   Krad_1200
  Exosomal proteins of bladder cancer cells
   Krad_1200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: ABS02688
UniProt: A6W799
Position
complement(1045137..1046579)
Genome map
AA seq 480 aa AA seqDB search
MTTAPQTAQSGSPADGSGPEQPTIFVMYGATGDLSRRLVSPAFFELARLGRLPRQWRLIG
CGRGEKTHEEFRDFIREALEEFGPQPADGPWDEFAANLLFAGGGFTEADSGELPGVLAQA
REALGGEAELVHYLAIPPGAFLDTTKGFEAHGLVEGSRVVYEKPYGTSLASFEELDAEVQ
RVFDESQVFRIDHFLAFEAQQDVMHARFANPWLASIWNREHVAQVQVDVAETLDVAQRAS
FYDATGAFLDMIVTHLFQMAATVAMEPPADLGPGALQAARDAALQDFRELDPAEVVLGQF
EGYTDIDGVPDDSTTDTLAAARVWIDNDRWRGVPFLLRSGKRMTADEQRVTLVLRTPEDG
PYAGSATAPSTISFSLLEGGAVDVALTVREPGVAGGTTQGTATLPLAGLGEPALPYVHLI
EHVLTGDRSLFTGVEGLRAAWTCIERFSNDRPAVLPYAPGTWGPEAADALAEPGQWFLRS
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaccgcaccgcagacagcgcagtccggcagcccggccgacgggtccggcccggag
cagcccacgatcttcgtgatgtacggcgccaccggcgacctctcccgccggctggtctcc
ccggccttcttcgagctcgcccgcctgggccggctgccccggcagtggcgcctgatcggg
tgcgggcggggggagaagacccacgaggagttccgcgacttcatccgcgaggcgctggag
gagttcggcccgcagcccgccgacggcccctgggacgagttcgccgcgaacctgctgttc
gccgggggcgggttcaccgaggccgactcgggcgagctgcccggggtcctggcgcaggcc
cgcgaggcgctggggggcgaggcggagctggtgcactacctggccatcccgccgggggcc
ttcctggacaccacgaagggcttcgaggcgcacggtctcgtcgagggttcccgcgtcgtc
tacgagaagccctacggcacctcgctggcgagcttcgaggagctcgacgccgaggtccag
cgggtgttcgacgagtcccaggtcttccgcatcgaccacttcctggccttcgaggcgcag
caggacgtcatgcacgcccggttcgccaacccgtggctggcctcgatctggaaccgcgag
cacgtcgcgcaggtccaggtcgacgtcgccgagaccctcgacgtcgcccagcgcgcaagc
ttctacgacgcgaccggcgcgttcctggacatgatcgtgacccacctgttccagatggcc
gccacggtcgccatggaaccccccgccgacctcggccccggggccctgcaggccgcgcgc
gacgccgcgctgcaggacttccgcgagctggacccggccgaggtggtgctggggcagttc
gagggctacaccgacatcgacggcgtccccgacgactccacgaccgacaccctcgccgcg
gcgcgggtgtggatcgacaacgaccgctggcgcggggtgccgttcctgctgcgctcgggc
aagaggatgaccgccgacgagcagcgggtcaccctcgtcctgaggacccccgaggacggt
ccctacgccgggtccgcgacggcgccctcgaccatcagcttctcgctgctcgagggcggc
gcggtcgacgtggcgctgaccgtgcgcgagccgggcgtggccgggggcacgacgcagggg
acggcgacgctgccgctggccgggctgggcgaacccgccctgccctacgtccacctcatc
gagcacgtcctcaccggcgaccggtcgctgttcaccggggtcgagggcctgcgcgcggcg
tggacctgcatcgagcggttctcgaacgaccgccccgcggtgctgccctacgcgccgggc
acctggggcccggaagccgccgacgcgctcgcggaaccggggcagtggttcctgaggtcg
tga

DBGET integrated database retrieval system