KEGG   Kineococcus radiotolerans: Krad_1202Help
Entry
Krad_1202         CDS       T00562                                 

Definition
(GenBank) hypothetical protein
Organism
kra  Kineococcus radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MtN3_slv PQ-loop
Motif
Other DBs
NCBI-ProteinID: ABS02690
UniProt: A6W7A1
Position
1043938..1044624
Genome map
AA seq 228 aa AA seqDB search
MPAPALVPALGLVAAAIGILTGVPQVLRLLRNPDASGLSYSSAILGVLSSATWLTYGTLL
LDPAQLVANVPGLGCAVVTVVLAARRLGVALTPALAATLAWVPVVVGAHVAGGAAAVGAV
ATAVSLVRMLPQVRTVLRREPLHGLAPAGFVLTQVSAALWTVYGCATGQVSVVVCSAVSA
VLAGIVLSRCCPPLAVARALHSGRFGLPGRLLVRPLVLLRRATLTLAA
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgctcccgccctcgtccccgccctcggcctcgtggccgccgccatcggcatcctc
accggtgtcccgcaggtcctgcgcctgctgaggaaccccgacgccagcgggctgtcgtac
tcctcggcgatcctgggcgtgctgtcctcggcgacgtggctcacctacggcacgctgctc
ctggaccccgcgcagctggtcgccaacgtgcccggcctgggctgcgcggtcgtcaccgtg
gtgctggccgcgcggcggctgggggtggcgctgaccccggcgctggccgcgacgctggcc
tgggtgccggtcgtcgtcggcgcccacgtggccggcggggccgcggcggtcggggcggtc
gccaccgccgtgtcgctggtgcggatgctcccgcaggtccgcaccgtcctgcgccgcgaa
cccctgcacggcctggcgccggccgggttcgtcctcacccaggtctcggccgcgctgtgg
acggtctacggctgcgcgaccgggcaggtctcggtggtcgtctgctccgcggtctccgcg
gtcctcgccgggatcgtgctctcccgctgctgcccgccgctggcggtggcccgcgccctg
cactccgggcgcttcggcctccccgggcggctgctggtgcggccgctggtcctgctccgc
cgcgccaccctcaccctggccgcctga

DBGET integrated database retrieval system