KEGG   Kineococcus radiotolerans: Krad_1203Help
Entry
Krad_1203         CDS       T00562                                 

Definition
(GenBank) MscS Mechanosensitive ion channel
Organism
kra  Kineococcus radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MS_channel DUF3810
Motif
Other DBs
NCBI-ProteinID: ABS02691
UniProt: A6W7A2
Position
1042749..1043867
Genome map
AA seq 372 aa AA seqDB search
MSVLDPLRSRSPVNISTSVWLTLAVAAVSAALAALLGEAVALGVRRLGRKREILATLAQR
GRRPLAGFLATLAARTSLGVYTRAADWRDPTFSVLNLLTVAFAAWLAVVAVNVVQDVALL
RYRIDVADNRRARQRRTQVTLVRRVVVALIVVVAVASVLLTIPGARGVGTSVLASAGLLS
VVAGLAAQTSLANIFAGLQIAFTDAIRVDDVVVVEEEWGNIEDITLTYVVVRLWDQRRLI
LPSTYFTTTPFANWTRNSSDIVGAVELDVDWNVPVERLRSHAEAFVKDHPLWNGQTYVLQ
VTEARNSFVTLRVLVSADSGGELFDLRCAVREELVGFLRREHPDALPRLRVATPPPVHLP
QQHDGRRSPHGV
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgtccgttctcgatcccctgaggagccgctcccccgtgaacatcagcacctccgtctgg
ctcaccctggccgtcgccgcggtctcggccgcgctggccgccctgctcggtgaggccgtc
gccctcggcgtgcgccggctgggccgcaagcgcgagatcctcgcgacgctggcccagcgc
ggtcgccgtccgctggcgggtttcctcgcgacgctggcggcccggacctccctcggcgtc
tacacccgggcggccgactggcgggacccgacgttctccgtcctcaacctgctgacggtc
gccttcgccgcctggctggccgtcgtcgccgtgaacgtcgtgcaggacgtggccctgctg
cgctaccgcatcgacgtcgccgacaaccgccgcgcccgccagcgccggacccaggtcacc
ctggtgcggcgcgtggtggtggcgctgatcgtggtggtcgccgtggcctccgtgctgctg
acgatccccggcgcgcgcggggtcgggacgagcgtgctggcctcggcggggctgctgtcg
gtggtggccggcctcgccgcgcagacgtcgctggccaacatcttcgcggggttgcagatc
gcgttcaccgacgccatccgcgtcgacgacgtcgtcgtcgtcgaggaggaatgggggaac
atcgaggacatcaccctcacctacgtcgtggtccggttgtgggaccagcgccggctcatc
ctgccctcgacgtacttcacgacgaccccgttcgcgaactggacgcggaactcctccgac
atcgtgggtgccgtcgagctcgacgtcgactggaacgtcccggtggagcggttgcgttcg
cacgcagaagctttcgtgaaggaccacccgttgtggaacggccagacgtacgtcctgcag
gtgaccgaggcgaggaactcgttcgtcaccctgcgggtgctggtcagcgcggactccggc
ggggaactgttcgacctgcgctgcgcggtgcgcgaggagctcgtcgggttcctgcgccgg
gagcaccccgacgcgctgccgaggctcagggtcgcgaccccgccgccggtgcacctgccg
cagcagcacgacgggcggcggtccccgcacggggtgtga

DBGET integrated database retrieval system