KEGG   Kineococcus radiotolerans: Krad_1208Help
Entry
Krad_1208         CDS       T00562                                 

Definition
(GenBank) GTPase EngC
  KO
K06949  ribosome biogenesis GTPase / thiamine phosphate phosphatase [EC:3.6.1.- 3.1.3.100]
Organism
kra  Kineococcus radiotolerans
Pathway
kra00730  Thiamine metabolism
kra01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kra00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Krad_1208
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:kra03009]
    Krad_1208
Enzymes [BR:kra01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.100  thiamine phosphate phosphatase
     Krad_1208
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-  
     Krad_1208
Ribosome biogenesis [BR:kra03009]
 Prokaryotic Type
  GTPases
   Krad_1208
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RsgA_GTPase MMR_HSR1 ABC_tran AAA_16 AAA_29 AIG1 Septin NACHT AAA_22 AAA_30 AAA_25 AAA_33 Roc FeoB_N RNA_helicase
Motif
Other DBs
NCBI-ProteinID: ABS02696
UniProt: A6W7A7
Position
1038235..1039344
Genome map
AA seq 369 aa AA seqDB search
MGVHARRDPGLSPGQRGPRARWDEDDVRVRPNPKGSRPRTKERPAHADAVDGFVVAVDRG
RSYCLVGEGTPQQRVVRAMRARELGRQGVVVGDRVGLVGDVSGTPDTLARIVRIDERRTA
LRRSADDTDPIERVVVANADQLVVVTAVANPEPRSRLVDRCLVAAYVSGMQPLLCLTKGD
LRPAEEVLGTWAPFGLDAVVTSRGPEGLLGLAEVRERLEGRTSVLVGHSGVGKSTLVNAL
VPDADRATGHVNAVTGRGRHTSTSMAALALPGGGWVIDTPGIRGFGLAHVDPEAVLRAFP
DLLPGERECPRGCTHDEPDCGLDGWVAQGRAGAAGAVRLASFRRLLAARRPAREDQVGPD
EPPEVPVDA
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
gtgggcgtccatgctcgccgggaccccggcctgagcccgggtcagcgcggtccccgcgcg
cgctgggacgaggacgacgtccgggtccggcccaacccgaaggggtcgcggccgcggacc
aaggaacgccccgcgcacgccgacgccgtcgacgggttcgtcgtcgccgtggaccgcggg
cgctcgtactgcctggtcggggagggcacgccgcagcagcgcgtcgtgcgggcgatgcgc
gcgcgcgagctgggccggcagggcgtcgtcgtgggcgaccgcgtcgggctcgtgggcgac
gtgtcggggaccccggacaccctggcccgcatcgtccgcatcgacgagcggcgcaccgcg
ctgcgccgctccgccgacgacaccgaccccatcgagcgggtcgtggtcgccaacgccgac
cagctcgtggtcgtcaccgccgtggcgaacccggagccccggtcccggctggtggaccgg
tgcttggtcgcggcctacgtgtcgggcatgcagccgctgctgtgcctgaccaagggggac
ctgcgcccggccgaggaggtgctggggacgtgggcccccttcgggctggacgccgtggtg
acctcgcgcgggccggagggcctgctggggctggcggaggtccgcgagcgcctggagggg
cgcacgagcgtgctcgtcgggcactcgggggtcgggaagtcgaccctggtgaacgcgctg
gtgcccgacgccgaccgcgccacgggccacgtcaacgccgtcaccggccgggggcggcac
acctcgacgtcgatggcggcgctggccctgccgggcggcgggtgggtgatcgacaccccg
ggcatccgcggcttcgggctggcccacgtcgaccccgaggccgtgctgcgcgccttcccc
gacctgctgcccggggagcgggagtgcccgcgcggctgcacccacgacgaacccgactgc
ggcctggacgggtgggtcgcgcaggggcgcgccggggcggcgggggcggtgcggctggcc
tccttccgccggctgctggcggcccggcggcccgcgcgcgaggaccaggtcggtcccgac
gagccgcccgaggtccctgtcgacgcctga

DBGET integrated database retrieval system