KEGG   Kineococcus radiotolerans: Krad_1212Help
Entry
Krad_1212         CDS       T00562                                 

Definition
(GenBank) RNA polymerase, sigma-24 subunit, ECF subfamily
  KO
K03088  RNA polymerase sigma-70 factor, ECF subfamily
Organism
kra  Kineococcus radiotolerans
Brite
Transcription machinery [BR:kra03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     Krad_1212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma70_r2 Sigma70_r4_2 Sigma70_r4 Sigma70_ECF
Motif
Other DBs
NCBI-ProteinID: ABS02700
UniProt: A6W7B1
Position
complement(1034667..1035440)
Genome map
AA seq 257 aa AA seqDB search
MSFAPPLEPSRRVDARRGQPRTTAGPPGRRDGRGPRAARGAVPQGLPSDAMTEQTDRAPS
EESADERAARFERDALPFLDQLYSAALRMTRNPADAEDLVQDAFAKAYGAFHQFTPGTNL
KAWLYRILTNTYINTYRKKQREPQQSHSDEIEDWQLARAESHQSTGLRSAETEALEHLPD
SDVKRALQQVPEDFRLAVYLADVEGFAYKEIAEIMGTPIGTVMSRLHRGRRLLRELLRDY
AVGRGVSGAVPETEGAS
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttcgccccacctctcgagccctcccgcagggtcgacgcgcgccggggacagccg
cgcacgaccgccggtccaccgggtcgccgcgacggccggggtccccgcgccgcgcgcggc
gccgtcccgcagggcctaccctcggacgcgatgaccgaacagaccgacagggccccctcc
gaggagagcgccgacgagcgcgccgctcgcttcgagcgcgacgcgctgcccttcctggac
cagctgtactccgccgcgctgcgcatgacgcgcaaccccgccgacgccgaggacctcgtc
caggacgccttcgccaaggcctacggcgcgttccaccagttcaccccggggaccaacctc
aaggcgtggctgtaccggatcctgacgaacacgtacatcaacacgtaccgcaagaagcag
cgcgagccgcagcagtcccactccgacgagatcgaggactggcagctggcccgggcggag
tcgcaccagtccaccgggctgcgctcggccgagaccgaggcgctggagcacctgccggac
tccgacgtgaagcgggccctgcagcaggtgccggaggacttccggctggcggtgtacctc
gccgacgtcgagggcttcgcctacaaggagatcgccgagatcatgggcaccccgatcggg
acggtgatgtcccggctgcaccgcggtcgtcgtctgctgcgcgagctgctgcgcgactac
gccgtcggccgcggggtctcgggtgccgtaccggagacggagggagcgtcgtga

DBGET integrated database retrieval system