KEGG   Kineococcus radiotolerans: Krad_1213Help
Entry
Krad_1213         CDS       T00562                                 

Definition
(GenBank) Anti-sigma factor RshA
Organism
kra  Kineococcus radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: zf-HC2 FMN_red Mating_C
Motif
Other DBs
NCBI-ProteinID: ABS02701
UniProt: A6W7B2
Position
complement(1034398..1034670)
Genome map
AA seq 90 aa AA seqDB search
MSASGPSTGELGRCREVLERAFEYLDGEMADLDCVQLKAHLEECASCVEQLAEDEKLKRV
IRDGCPCEEAPATLRARILVQMTEVVVTSR
NT seq 273 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcgtcgggaccgagcacgggggagctgggccgctgccgggaggtgctggagcgc
gccttcgagtacctcgacggcgagatggccgacctggactgcgtccagctgaaggcccac
ctcgaggagtgcgcgagctgcgtggagcagttggccgaggacgagaagctcaagcgggtc
atccgcgacggctgcccctgcgaggaggcgccggccacgctgcgcgcccgcatcctcgtg
cagatgaccgaggtcgtcgtcacctcgcgctga

DBGET integrated database retrieval system