KEGG   Kineococcus radiotolerans: Krad_1218Help
Entry
Krad_1218         CDS       T00562                                 

Definition
(GenBank) protein of unknown function DUF664
Organism
kra  Kineococcus radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF664 DinB_2 DinB
Motif
Other DBs
NCBI-ProteinID: ABS02706
UniProt: A6W7B7
Position
1028074..1028592
Genome map
AA seq 172 aa AA seqDB search
MTLVPYTAGEKPSLVASLQRHREVVLWKLEDLDDEQLRRPVVGSGTTLLGTAKHLASVEY
RWFCSAFGRPSDEIPAEAVAEDPQAHWRIHPWETTEGVLAYYERARTAADEALRELKVSE
RGTTPDGAVVTLRWALLHVIEETARHAGHLDVLRELVDGRTGDHRPAPSAAS
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgaccctcgtgccctacaccgcgggagagaagccgagcctcgtggccagcctgcagcgc
caccgcgaggtggtgctgtggaagctcgaggacctcgacgacgagcagctgcgacgaccc
gtggtgggctccggcaccaccctgctggggacggcgaagcacctcgccagcgtcgagtac
cgctggttctgctccgccttcgggcgccccagcgacgagatccccgccgaggccgtggcc
gaggacccgcaggcccactggcggatccacccctgggagaccaccgagggcgtcctggcc
tactacgagcgcgcccgcaccgcggccgacgaggccctgcgcgagctgaaggtcagcgag
cgcgggacgacgccggacggggccgtggtgaccctgcgctgggcgctgctgcacgtgatc
gaggagaccgcccggcacgccgggcacctcgacgtcctgcgcgagctggtcgacgggcgc
accggggaccaccggccggccccgtccgcggcgtcctga

DBGET integrated database retrieval system