KEGG   Kineococcus radiotolerans: Krad_1222Help
Entry
Krad_1222         CDS       T00562                                 

Definition
(GenBank) ABC transporter related
  KO
K02028  polar amino acid transport system ATP-binding protein [EC:3.6.3.21]
Organism
kra  Kineococcus radiotolerans
Module
kra_M00236  Putative polar amino acid transport system
Brite
Enzymes [BR:kra01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.21  polar-amino-acid-transporting ATPase
     Krad_1222
Transporters [BR:kra02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Putative polar amino acid transporter [MD:M00236]
    Krad_1222
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_16 AAA_30 AAA_23 AAA_29 NACHT AAA_33 SbcCD_C AAA_24 RsgA_GTPase AAA_25 TsaE AAA_22 ABC_ATPase AAA_18 AAA AAA_5 AAA_15 AAA_19 G-alpha
Motif
Other DBs
NCBI-ProteinID: ABS02710
UniProt: A6W7C1
Position
1024540..1025316
Genome map
AA seq 258 aa AA seqDB search
MSALVEARGVHKAFGHVEVLKGIDLDVEAGEVVCLLGPSGSGKTTFLRCINSLERIDGGR
IRVDGELVGLEERGGRLHRLTDKRIAQQRRDIGMVFQRFNLFPHMSALENVVEAPVRVRG
VAKAEANRRAVELLERVGLADRAHNYPAQLSGGQQQRVAIARALAMQPKLMLFDEPTSAL
DPELVGEVLEVMRELAADGTTMVVVTHEVAFARDVADQVVFMDGGVVVERGTPAEVIGDP
REERTRTFLARMRTGQDG
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgccctggtggaggcccgcggcgtccacaaggccttcggccacgtcgaggtcctc
aagggcatcgacctcgacgtcgaggccggcgaggtcgtctgcctgctgggtccgtcgggt
tcgggcaagacgacgttcctgcgctgcatcaactccctggaacgcatcgacggcggccgc
atccgcgtcgacggcgagctcgtcgggctggaggagcgcggggggcggttgcaccgcctg
accgacaagcggatcgcccagcagcgccgcgacatcggcatggtgttccagcggttcaac
ctgttcccgcacatgagcgccctggagaacgtcgtcgaggccccggtgcgggtccggggc
gtggcgaaggcggaggcgaaccgccgggcggtggagctgctcgaacgggtcggactggcc
gaccgcgcgcacaactacccggcgcagttgtccggcgggcagcagcagcgggtcgcgatc
gcgcgggcgctggccatgcagcccaagctcatgctgttcgacgagccgacctcggcgctg
gaccccgagctcgtgggcgaggtgctggaggtcatgcgcgagctggccgcggacggcacg
acgatggtcgtcgtgacccacgaggtcgccttcgcccgcgacgtcgccgaccaggtcgtc
ttcatggacggcggggtcgtcgtggagcgagggaccccggcggaggtcatcggcgacccc
cgcgaggaacgcacccggaccttcctggcccggatgcgcaccggccaggacggctga

DBGET integrated database retrieval system