KEGG   Kineococcus radiotolerans: Krad_1228Help
Entry
Krad_1228         CDS       T00562                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E1 subunit
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
kra  Kineococcus radiotolerans
Pathway
kra00020  Citrate cycle (TCA cycle)
kra00310  Lysine degradation
kra00380  Tryptophan metabolism
kra01100  Metabolic pathways
kra01110  Biosynthesis of secondary metabolites
kra01120  Microbial metabolism in diverse environments
kra01130  Biosynthesis of antibiotics
kra01200  Carbon metabolism
Module
kra_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kra_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:kra00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Krad_1228
  Amino acid metabolism
   00310 Lysine degradation
    Krad_1228
   00380 Tryptophan metabolism
    Krad_1228
Enzymes [BR:kra01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     Krad_1228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh Transket_pyr 2-oxoacid_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: ABS02716
UniProt: A6W7C7
Position
1015434..1019297
Genome map
AA seq 1287 aa AA seqDB search
MPPQASHPEDKIAATFGPNEWLVDELYEQYLADKNSVDEAWWEFFEDYSPADNPAGTTQS
TPPGTNGSRAPEAHGTPTGAVPGSGTAAGRQPAEGKPANGKPAPQQVPKATATQPEQPAP
SPAPAPATVPTAVKAPVRADAPLKGAPAAAATAPAGAPTAPAEDTVTPLRGPAARVVSNM
EDSLEVPTATSVRAVPAKLLVDNRIVINNHLKRSRGGKVSFTHLIGFAVVEALAAMPSMN
AAYTTDAKGKPAVLQPAHVNLGIAIDLPKPDGSRQLMVPAVKQSESKNFSEFWSAYEDVV
RRARAGKLTADDFAGTTISLTNPGTIGTVHSVPRLVKGQGAIIGVGAMEYPAEYQGASEE
TLTRLAVSKVITLTSTYDHRIIQGAGSGEFLRIVHAKLLGEDGFYDRVFQSLHIPYQPIR
WTSDISVSHDDQINKTARVVELIHAYRVRGHLMADTDPLEYRQRVHPDLEIETHGLTLWD
LDREFPTGGFGGKAHMKLRDVLGVLRDSYCRTVGIEYMHIQEPDQRRWIQDRVERPYAKP
SAAVQLRILRRLNAAEAFETFLQTKYVGQKRFSLEGGESVIALLDALLSRAATNGMDEVC
LGMAHRGRLNVLTNIAGKSYSQVFREFEGMQDPRTVQGSGDVKYHLGTEGTFTGEDGEQT
KVYVAANPSHLEAVDPVLEGVARAKQDRINMAGKSFPVLPVLLHGDAAFAGQGVVAETLN
LSQLRGYRTGGSVHVVINNQVGFTTAPASSRSSVYCTDVGRMIQAPIFHVNGDDPEACVR
VAQLAFEFRQAFEKDVVIDMVCYRRRGHNEGDDPSMTQPLMYNLIEKKRSVRKSYTEQLI
GRGDISVEEAEEALRDYSAQLERAFAETKESKSGPVDGDSRGGLERPAAQEADEQTPART
HPTAVDASVLQHIGQVQATPPQGFTVHPKLRQLLDKRAQMSTDGGIDWGWGELLAFGSLL
MEGTPVRLAGQDSRRGTFVSRHAVLTDRVTGDEWTPLLYLGREGAEQAKFWIYDSLLSEY
AAMGFEYGYSVERPDALVLWEAQFGDFFNGAQTVIDEFIVAGEQKWGQRSSVVLLLPHGY
EGQGPDHSSGRIERFLQMCAEDNMTVAVPSTPASYFHLLRRQAYARPRKPLVVFTPKSML
RLKAAQSAVEDFTTGTFREVVGDQGGLDASAVTRVLLCSGKVYWDLVAERAARGDTTTAV
VRLEQLAPLPVEQVLAELGRYPGAEAVWVQEEPANQGGWWHVAMGLFPVLNAKLRLVSRP
ASASPAAGSAKRHQAEQRQIVEEAFAR
NT seq 3864 nt NT seq  +upstreamnt  +downstreamnt
gtgcctccacaggcctcgcaccccgaggacaagatcgcagcaaccttcggccccaacgag
tggctcgtcgacgagctgtacgagcagtacctggccgacaagaactccgtcgacgaggcg
tggtgggagttcttcgaggactactcccccgccgacaaccccgcgggcaccacgcagtcc
actccccccggcacgaacggctcccgggcccccgaggcccacggcacccccaccggcgcc
gtccccggcagcggcaccgcggccggcaggcagcccgccgaggggaagcccgccaacggg
aagcccgccccgcagcaggtcccgaaggccaccgccacccagcccgagcagccggcgccg
tcgccggctcccgccccggcgacggtgcccaccgcggtcaaggcccccgtgcgcgccgac
gcgccgctgaagggcgcgcccgcggccgcggcgaccgcccccgccggtgcgccgaccgcg
cccgcggaggacaccgtcaccccgctgcgcggtcccgccgcgcgcgtggtgagcaacatg
gaggactccctcgaggtccccacggcgacgagcgtgcgcgcggtcccggcgaagctgctg
gtcgacaaccgcatcgtcatcaacaaccacctcaagcggtcccgcggcgggaaggtctcc
ttcacccacctcatcgggttcgccgtcgtcgaggccctggccgcgatgccgtcgatgaac
gccgcctacaccaccgacgccaagggcaagccggccgtcctgcagccggcgcacgtgaac
ctcggcatcgccatcgacctgcccaagcccgacggttcccgccagctcatggtgcccgcg
gtgaagcagtcggagtccaagaacttctccgagttctggagcgcctacgaggacgtcgtg
cgccgcgcccgcgcgggcaagctcaccgccgacgacttcgccggcaccaccatcagcctc
accaacccgggcaccatcggcacggtccactccgtgccgcgcctggtgaaggggcagggc
gcgatcatcggcgtcggggcgatggagtacccggccgagtaccagggcgccagcgaggag
accctgacccgcctggcggtcagcaaggtcatcacgctgacctcgacctacgaccaccgc
atcatccagggcgcggggtcgggcgagttcctgcggatcgtgcacgcgaagctgctgggc
gaggacgggttctacgaccgcgtcttccagtcgctgcacatcccctaccagccgatccgc
tggacctcggacatctccgtctcccacgacgaccagatcaacaagaccgcccgcgtggtc
gagctgatccacgcctaccgcgtccgcggccacctcatggccgacaccgacccgctggag
taccgccagcgcgtccaccccgacctcgagatcgagacccacggcctcaccctgtgggac
ctcgaccgggagttccccaccgggggcttcggcggcaaggcgcacatgaagctgcgcgac
gtcctcggggtgctgcgcgactcctactgccgcaccgtcggcatcgagtacatgcacatc
caggagcccgaccagcgccgctggatccaggaccgggtggagcgcccctacgccaagccc
tcggcggccgtgcagctgaggatcctgcgccggctcaacgccgcggaggccttcgagacg
ttcctgcagacgaagtacgtgggccagaagcgcttctccctcgagggcggggagtccgtc
atcgccctgctcgacgcgctgctctcgcgggcggcgaccaacggcatggacgaggtctgc
ctgggcatggcccaccgcggccggctcaacgtgctgaccaacatcgccggcaagagctac
tcgcaggtgttccgcgagttcgagggcatgcaggacccgcgcaccgtgcagggctccggc
gacgtgaagtaccacctcggcaccgagggcaccttcaccggcgaggacggcgagcagacc
aaggtctacgtcgccgcgaacccctcccacctcgaggccgtcgacccggtgctggagggg
gtggcgcgcgccaagcaggaccggatcaacatggcgggcaagagcttccccgtgctgccg
gtcctcctgcacggcgacgccgcgttcgccgggcagggcgtcgtggccgagacgctgaac
ctctcgcagctgcgcggctaccgcaccggcggctcggtgcacgtggtcatcaacaaccag
gtcgggttcaccaccgccccggcctcctcccgctcctcggtgtactgcaccgacgtcggg
cggatgatccaggcgccgatcttccacgtgaacggcgacgacccggaggcctgcgtccgg
gtggcgcagctggccttcgagttccgccaggcgttcgagaaggacgtcgtcatcgacatg
gtctgctaccgccgccgcggccacaacgagggcgacgacccctcgatgacgcagccgctg
atgtacaacctcatcgagaagaagcgcagcgtccgcaagagctacaccgagcagctcatc
gggcgcggcgacatatccgtcgaggaggcggaggaggcgctgcgcgactactcggcccag
ctcgagcgcgccttcgccgagaccaaggagtccaagtccggtcccgtcgacggcgacagc
cgcggcggcctggagcggcccgccgcgcaggaggccgacgagcagaccccggcccggacc
caccccacggccgtggacgcctccgtcctgcagcacatcggccaggtccaggcgaccccg
ccgcagggcttcaccgtccaccccaagctgcggcagctgctcgacaagcgcgcgcagatg
tccaccgacggcggcatcgactggggctggggcgagctgctcgcgttcgggtcgctgctc
atggaggggaccccggtccgcctcgccggccaggactcccgccgcggcaccttcgtctcc
cgccacgccgtcctcaccgaccgcgtcaccggcgacgagtggaccccgctgctctacctg
ggccgcgagggggccgagcaggcgaagttctggatctacgactccctgctgtccgagtac
gccgcgatgggcttcgagtacggctactccgtcgagcgccccgacgcgctggtgctgtgg
gaggcccagttcggggacttcttcaacggcgcgcagacggtcatcgacgagttcatcgtc
gcgggcgagcagaagtggggccagcgctcctcggtcgtgctgctgctgccgcacggctac
gagggccagggcccggaccactcctcgggccgcatcgagcggttcctgcagatgtgcgcc
gaggacaacatgaccgtggccgtcccctcgaccccggccagctacttccacctgctgcgc
cggcaggcctacgcccgcccgcgcaagccgctggtcgtcttcaccccgaagtcgatgctg
cgcctgaaggccgcccagtcggcggtggaggacttcacgacggggaccttccgggaggtc
gtcggcgaccagggcggcctggacgcctcggcggtcacccgggtgctgctgtgctcgggg
aaggtctactgggacctcgtcgccgagcgcgcggcgcgcggggacaccacgaccgccgtc
gtccggctggagcagctcgccccgctgccggtcgagcaggtcctggcggagctggggcgc
taccccggcgccgaggcggtgtgggtgcaggaggaaccggccaaccagggcggctggtgg
cacgtggcgatggggctgttccccgtgctgaacgccaagctgcggctggtctcccggccc
gcgtcggcctcccccgccgccgggtcggccaagcgccaccaggccgagcagcgccagatc
gtcgaggaggccttcgcccgctga

DBGET integrated database retrieval system