KEGG   Kineococcus radiotolerans: Krad_1229Help
Entry
Krad_1229         CDS       T00562                                 

Definition
(GenBank) integral membrane sensor signal transduction histidine kinase
Organism
kra  Kineococcus radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA HAMP HATPase_c_2 Pam16 HATPase_c_3 Baculo_PEP_C
Motif
Other DBs
NCBI-ProteinID: ABS02717
UniProt: A6W7C8
Position
1014148..1015338
Genome map
AA seq 396 aa AA seqDB search
MTPPPQEPQVGTGLTGPIPITGAAHDARAGAARTATRRPWPDVRPLDPVHSLKTKLALLV
GASVTVAALLVWGGLRLAEIHIGPRYTLPVAIVITLVFTQLLARGMTSPLRDMTAAARAM
AGGDYSRRVRSTSNDEVGELADAFNRMAEDLEAVDRERRELVANVSHELRTPVSALHAVM
ENLVDGVSEPDHETLATALAQTERLGRLVEQLLDLSRLDAGAVALDREELALEPFLAQAT
RAMSMTGRDVRFVLDVDPPGLSVDVDSARLHQVVANLLDNASRHSPPGGEVFVSAHAVGQ
VVRISVRDQGPGIPDADRERVFERFQRGSARTDGGTGLGLAIARWAVQLHGGTIRVAPTP
EEGGCRIDVHLPRVTEGAPGVTKTSAGEGARHDLRG
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtgacccctcccccgcaggagccgcaggtcgggacgggcctgaccggcccgatccccatc
accggcgcggcgcacgacgcccgcgccggggcggcccgcacggcgacccgccgcccgtgg
ccggacgtgcggccgctggacccggtgcactcgctgaagacgaagctggccctgctcgtg
ggggcctcggtcaccgtcgcggcgctgctggtctggggcggcctgcggctggcggagatc
cacatcggcccccgctacacgctgccggtcgcgatcgtcatcaccctcgtcttcacccag
ctgctggcccggggcatgacctcgccgctgcgggacatgacggccgcggcccgcgcgatg
gccggcggcgactactcccggcgggtgcgctcgacctccaacgacgaggtcggggagctg
gccgacgccttcaaccggatggccgaggacctggaggccgtggaccgcgagcgccgggag
ctggtggcgaacgtgagccacgagctgcgcacgccggtctcggcgctgcacgcggtgatg
gagaacctcgtcgacggcgtctcggagcccgaccacgagaccctggcgacggcgctggcg
cagacggagcggctgggccggctcgtggagcagctgctggacctctcgcgcctggacgcg
ggggcggtggcgctggaccgcgaggagctggccctggagccgttcctggcccaggcgacg
cgggcgatgtcgatgacggggcgcgacgtgcggttcgtcctggacgtggacccgccgggg
ctgagcgtggacgtggactccgcgcggttgcaccaggtggtggcgaacctgctggacaac
gcctcgcggcactccccgccggggggcgaggtgttcgtctccgcgcacgcggtgggccag
gtggtgcggatcagcgtgcgggaccaggggccggggatccccgacgccgaccgggagcgg
gtgttcgagcgcttccagcgcggcagcgcccgcaccgacggcgggacgggcctggggctg
gccatcgcccgctgggcggtgcagctgcacggcggcacgatccgggtggccccgacaccg
gaggaggggggctgccgcatcgacgtccacctgcccagggtgacggagggagcacccggt
gtgacgaagacctcagcgggcgagggcgcccgacacgacctccggggctga

DBGET integrated database retrieval system