KEGG   Kineococcus radiotolerans: Krad_1233Help
Entry
Krad_1233         CDS       T00562                                 

Definition
(GenBank) hypothetical protein
Organism
kra  Kineococcus radiotolerans
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABS02721
UniProt: A6W7D2
Position
complement(1010601..1010885)
Genome map
AA seq 94 aa AA seqDB search
MDETRSEPVVSGRDYSVDDVRGRPATGLGDFEGETSFSLTRGPHRHEVVGVGTVVDGMAL
VHEKQGVHGGGLDVRVWQVTAAPGGFAAQHVAEF
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atggacgaaacacgcagcgagccggtcgtctccggccgggactactccgtcgacgacgtg
cgcggccggcccgcgacgggtctgggcgacttcgagggggagacgtccttctcgctgacc
cgcggtccgcaccgccacgaggtcgtcggggtcgggaccgtcgtcgacgggatggccctg
gtgcacgagaagcagggggtgcacggcggtgggctcgacgtccgcgtgtggcaggtgacg
gccgcccccggcgggttcgcggcccagcacgtcgccgagttctga

DBGET integrated database retrieval system