KEGG   Kineococcus radiotolerans: Krad_1234Help
Entry
Krad_1234         CDS       T00562                                 

Definition
(GenBank) protein of unknown function DUF21
Organism
kra  Kineococcus radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF21 CorC_HlyC CBS
Motif
Other DBs
NCBI-ProteinID: ABS02722
UniProt: A6W7D3
Position
complement(1009075..1010436)
Genome map
AA seq 453 aa AA seqDB search
MLTEWLLLLVGVLLTLGTAVFVAAEFALVTLDRFSVEKAVEDGDKRAAGILPALRTLSTQ
LSGAQVGITLTTLLVGYLTKPSLASLLNGPLTSAGLSPDSADSVAGILAVVVAAAFSMVV
GELIPKNLALSVPLRTAGVVAPLQRGFTWATGPLLKVLNGSANWFLRRIGVEPQEELSGA
RSARELAALVRRSADMGTLDEGTANLISRSLLFGDQTAADVMTPRVRMEAIRLDETAADV
VARARTTGHSRFPVTGDDDDDVRGVVHVKAAVAVPPERRHDVPAAALMADARRVPDSLTL
EPLLLQLRQKGLQLAVVVDEYGGTAGVVTLEDLVEEIVGDVSDEHDRDRGGLRQHRDASW
TVPGLARPDEVRDATGVEVPEDPAYETLGGFVMSRLRRIPAVGDEIELDGAVLRVARMEG
RRVERLRLRPRPVTPVGTVPAPEAAGAVAGGDR
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
gtgctgaccgagtggctcctcctgctcgtcggggtcctcctcaccctcggcaccgcggtc
ttcgtcgcggccgagttcgcgctcgtcaccctcgaccggttcagcgtcgagaaggccgtc
gaggacggcgacaagcgcgccgccgggatcctgccggcgctgcgcaccctctccacccag
ctctccggcgcccaggtcgggatcaccctgaccacgctgctggtcgggtacctgaccaag
ccctcgctggcgtccctgctcaacggcccgctgacctccgccggtctcagccccgacagc
gccgactccgtcgccgggatcctcgccgtcgtcgtcgcggcggcgttctcgatggtcgtc
ggcgagctcatccccaagaacctcgccctcagcgtcccgctgcggaccgcgggcgtggtg
gcccccctgcagcgcgggttcacctgggccaccgggccgctgctgaaggtcctcaacggc
agcgccaactggttcctgcgccgcatcggcgtcgaaccccaggaggagctgtccggggcc
cgctcggcccgcgagctcgcggcgctggtgcgccgctccgcggacatggggaccctcgac
gagggcaccgccaacctcatcagccgctccctgctcttcggcgaccagaccgccgccgac
gtcatgaccccccgggtgcggatggaggcgatccgcctcgacgagaccgccgccgacgtc
gtcgcccgcgcccgcaccaccggccactcccgcttccccgtcaccggcgacgacgacgac
gacgtgcgcggggtggtccacgtcaaggccgccgtcgccgtcccgccggagcgccgccac
gacgtcccggccgccgcgctcatggccgacgcccgtcgcgtgccggactccctgaccctc
gaaccgctgctgctgcagctgcggcagaaggggttgcagctcgccgtcgtcgtcgacgag
tacggcgggacggccggggtcgtcaccctggaggacctcgtggaggagatcgtcggggac
gtctccgacgagcacgaccgcgaccgcgggggcctgcgccagcaccgcgacgcctcctgg
accgtcccgggcctggcccgtcccgacgaggtccgcgacgccaccggcgtggaggtcccg
gaggaccccgcctacgagaccctcggagggttcgtcatgtcccgcctgcgccgcatcccc
gccgtgggcgacgagatcgagctcgacggggccgtgctgcgcgtggcgcggatggagggc
cgccgggtggagcggctgcggctgcgtccccgcccggtcacccccgtcggcaccgtcccg
gcccccgaggcggccggcgccgtcgcgggaggtgaccggtga

DBGET integrated database retrieval system