KEGG   Kineococcus radiotolerans: Krad_1236Help
Entry
Krad_1236         CDS       T00562                                 

Definition
(GenBank) conserved hypothetical protein
Organism
kra  Kineococcus radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRC
Motif
Other DBs
NCBI-ProteinID: ABS02724
UniProt: A6W7D5
Position
1007602..1007964
Genome map
AA seq 120 aa AA seqDB search
MSILVQDLNQWKSAPVLDVSDAKIGTLASVYVDAATDEWLFAAVETGVVGFKKAVLVPLD
GAAVGRHDIRVAFSKETVKAAPSFGTDEELGPDDEPRIYVHYGMEYSPADTPSGRRLARR
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcctcgtccaggacctgaaccagtggaagagcgcccccgtcctcgacgtgagc
gacgcgaagatcgggaccctggcctcggtctacgtcgacgcggccacggacgagtggttg
ttcgccgccgtcgagaccggcgtcgtcggcttcaagaaggccgtgctcgtgcccctggac
ggggccgcggtcggtcgtcacgacatccgggtggccttctccaaggagaccgtcaaggcg
gctcccagcttcggcaccgacgaggagctgggccccgacgacgagccgcggatctacgtg
cactacggcatggagtactcccccgccgacacccccagcggccgccgcctggcccgccgc
tga

DBGET integrated database retrieval system