KEGG   Kineococcus radiotolerans: Krad_1245Help
Entry
Krad_1245         CDS       T00562                                 

Definition
(GenBank) phosphoribosyltransferase
  KO
K07101  uncharacterized protein
Organism
kra  Kineococcus radiotolerans
Brite
KEGG Orthology (KO) [BR:kra00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Krad_1245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pribosyltran UPRTase PRTase_2 PRTase_3
Motif
Other DBs
NCBI-ProteinID: ABS02733
UniProt: A6W7E4
Position
996847..997347
Genome map
AA seq 166 aa AA seqDB search
MTSDAPAREVLTWSLFGEAVRDLASAIAAAGHRPEVVLGIARGGLPLAAGLAYALDVKET
ATINVEFYTGVDTRLPEPVVLPPSVDLTELAGRDVLVVDDVADTGRTLAVVLRMCREVGV
RARSVVVYRKPGTRLAPDHAWRETDRWIEFPWSAQGPVPEVERPSA
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
gtgacgtccgacgcccccgcccgcgaggtcctgacctggtcgctgttcggggaggccgtg
cgcgacctcgcctccgccatcgccgcggccggccaccgccccgaggtggtcctcggcatc
gcccggggcggcctgccgctggccgcgggcctcgcctacgccctggacgtgaaggagacc
gcgacgatcaacgtcgagttctacaccggggtggacacccggctgcccgaacccgtcgtg
ctgcccccctcggtggacctcaccgagctcgccgggcgcgacgtcctcgtcgtcgacgac
gtcgccgacaccggccgcaccctggccgtggtcctgcggatgtgccgcgaggtcggcgtc
cgggcccgctcggtcgtcgtctaccgcaagccggggacccggctggccccggaccacgcc
tggcgcgagaccgaccgctggatcgagttcccctggtcggcgcagggccccgtccccgag
gtggagcggccctcagcctga

DBGET integrated database retrieval system