KEGG   Kineococcus radiotolerans: Krad_1260Help
Entry
Krad_1260         CDS       T00562                                 

Definition
(GenBank) Sua5/YciO/YrdC/YwlC family protein
  KO
K07566  L-threonylcarbamoyladenylate synthase [EC:2.7.7.87]
Organism
kra  Kineococcus radiotolerans
Brite
Enzymes [BR:kra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.87  L-threonylcarbamoyladenylate synthase
     Krad_1260
Ribosome biogenesis [BR:kra03009]
 Prokaryotic Type
  Other maturation factors
   Krad_1260
Transfer RNA biogenesis [BR:kra03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    Krad_1260
 Prokaryotic Type
    Krad_1260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sua5_yciO_yrdC
Motif
Other DBs
NCBI-ProteinID: ABS02748
UniProt: A6W7F9
Position
complement(979836..980561)
Genome map
AA seq 241 aa AA seqDB search
MRPPFDCADPVIRERGLSAAHNAVKRGEVVVLPTDTVYGIGADAFNPAAVKRLLEAKGRG
RDMPPPVLVPETRTIDGLASSIPFAVRELIDAFWPGALTIVCRAQPSLTWDLGETNGTVA
LRMPLHPVALELLRRTGPMAVSSANLSGRPAATVVGEAVEQLGESVRVYLDGGPSTKGAP
STIVDASDGPLRVLRVGAISEAELRAAVPAGWVELEEPAVEEPTAEAGVEGGAERSGAAS
G
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
gtgaggcccccgttcgattgcgccgaccccgtcatccgcgagcgcggtctgtccgcagcg
cacaacgccgtcaagcgcggtgaggtggtcgtgctgcccaccgacaccgtctacggcatc
ggtgcggacgcgttcaaccccgccgccgtcaagcggctcctggaggcgaaggggcgcggg
cgcgacatgccgccgccggtcctggtgccggagacccggaccatcgacgggctcgcgtcc
tcgatcccgttcgcggtccgcgagctcatcgacgccttctggcccggggcgctgaccatc
gtctgccgggcccagccgtcgctgacctgggacctgggggagacgaacggcacggtcgcg
ctgcggatgccgctgcacccggtcgcgctggagctgctgcggcgcaccggcccgatggcc
gtctccagcgcgaacctctccggccgcccggccgcgacggtcgtcggcgaggccgtggag
cagctgggggagtcggtgcgggtctacctcgacggcgggccgagcacgaagggcgccccc
tccaccatcgtcgacgcctccgacggcccgctgcgcgtcctgcgggtgggggcgatcagc
gaggccgagctgcgggccgcggtgcccgcgggctgggtcgagctcgaggaaccggccgtc
gaggagccgaccgccgaggccggggtcgagggcggggccgagaggtcaggggccgcgagc
ggatga

DBGET integrated database retrieval system