KEGG   Kineococcus radiotolerans: Krad_1263Help
Entry
Krad_1263         CDS       T00562                                 

Definition
(GenBank) hypothetical protein
Organism
kra  Kineococcus radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATPase_gene1 DUF3482
Motif
Other DBs
NCBI-ProteinID: ABS02751
UniProt: A6W7G2
Position
complement(977845..978075)
Genome map
AA seq 76 aa AA seqDB search
MILDRPSNDASSDIGNGLTEKVAWSITSYLIAGAFMGAMAGWGVDHLLGTRFIVGIGLVV
GKALTLYYVWLRYGTH
NT seq 231 nt NT seq  +upstreamnt  +downstreamnt
gtgatcctcgaccggccgtcgaacgacgcgtccagcgacatcggcaacgggctgaccgag
aaggtcgcctggagcatcacctcgtacctcatcgccggggccttcatgggcgccatggcg
ggctggggcgtcgaccacctgctcgggacccgcttcatcgtggggatcggcctggtcgtc
ggcaaggcgttgaccttgtactacgtgtggctccggtacggtacgcactga

DBGET integrated database retrieval system