KEGG   Kineococcus radiotolerans: Krad_1266Help
Entry
Krad_1266         CDS       T00562                                 

Definition
(GenBank) ATP synthase F0, B subunit
  KO
K02109  F-type H+-transporting ATPase subunit b
Organism
kra  Kineococcus radiotolerans
Pathway
kra00190  Oxidative phosphorylation
kra01100  Metabolic pathways
Module
kra_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:kra00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Krad_1266
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:kra00194]
    Krad_1266
Photosynthesis proteins [BR:kra00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   Krad_1266
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_B Inhibitor_I53 DcuC Spc7 YMF19 hDGE_amylase Atg14 DUF3150
Motif
Other DBs
NCBI-ProteinID: ABS02754
UniProt: A6W7G5
Position
complement(976066..976632)
Genome map
AA seq 188 aa AA seqDB search
MLVAAFAAAGEEVEGNPTYPILPHLGELIVGIIFAIIIYAVIAKKVVPRLEAMYEERRAA
IEGNVEKAEKAQAEAQVALEQYKAQLADARGEANRIREEARQQGAQILAEMREQAQAESE
RITTAARATIEAERVQATAQLRAEVGRLATDLAGRIVGESLQDSARQSGVVDRFLADLER
SESGASSR
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
gtgctcgtagcagccttcgccgcagccggtgaagaggtcgaggggaacccgacctacccg
atcctgccgcacctcggcgagctgatcgtcggcatcatcttcgcgatcatcatctacgcg
gtgatcgcgaagaaggtcgtcccccgcctcgaagcgatgtacgaggagcggcgcgcggcc
atcgagggcaacgtcgagaaggcggagaaggcccaggcggaagcccaggtcgccctcgag
cagtacaaggcccagctcgcggacgcccgcggcgaggccaaccgcatccgcgaggaggcg
cgccagcagggtgcgcagatcctcgccgagatgcgggagcaggcgcaggccgagtccgag
cgcatcaccaccgcggcgcgcgcgaccatcgaggccgagcgcgtccaggccacggcgcag
ctgcgcgcggaggtcggccgtctcgcgaccgacctcgccggccgcatcgtgggtgagtcg
ctgcaggactccgctcgtcagagcggtgtcgtggaccggttcctcgccgacctcgagcgc
agcgagtcgggagcgtcctcccgatga

DBGET integrated database retrieval system