KEGG   Kineococcus radiotolerans: Krad_1267Help
Entry
Krad_1267         CDS       T00562                                 

Definition
(GenBank) ATP synthase F1, delta subunit
  KO
K02113  F-type H+-transporting ATPase subunit delta
Organism
kra  Kineococcus radiotolerans
Pathway
kra00190  Oxidative phosphorylation
kra01100  Metabolic pathways
Module
kra_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:kra00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Krad_1267
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:kra00194]
    Krad_1267
Photosynthesis proteins [BR:kra00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   Krad_1267
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OSCP
Motif
Other DBs
NCBI-ProteinID: ABS02755
UniProt: A6W7G6
Position
complement(975239..976069)
Genome map
AA seq 276 aa AA seqDB search
MSGELDAGVAKASLAAAQQVLDVQLSAEGADAGKTGEDLFAVTSLLDSSVGLRRALTDPS
RSGAAKAEFVRRTLSGRITPAALETVVALASARWAAGRDLSDATERLAVVAVVTQAERSG
HLDALEDELFRFARTVAGSPALRDALADRTAPDANRASLAARLLLGKASPETVQLARRAA
SSSRGMRAERLLEEWVEVVAKRREQLVAHVVSATPLTDAQRERLAATLSRQYGRAIRVNL
DVDPHLVGGLRVSVGDDVIDGSISTRLDEARRRLAG
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgagcggagagctcgacgccggcgtcgcgaaggcgagcctcgccgccgcgcagcaggtg
ctcgacgtgcagctgtcggccgagggggccgacgcgggcaagacgggggaggacctcttc
gccgtcaccagcctgctcgactcctcggtcggcctgcgccgggcgctgaccgacccctcc
cgctcgggggcggccaaggcggagttcgtccgccgcacgctgtccgggcggatcaccccg
gcggccctcgagaccgtcgtcgcgctggcctcggcccgctgggcggccggtcgcgacctg
tccgacgccaccgagcggctcgccgtcgtcgcggtcgtcacccaggccgagaggtcgggg
cacctggacgcgctggaggacgagctcttccggttcgcgcggaccgtcgcgggcagcccc
gcgctgcgggacgcgctggccgaccgcaccgcccccgacgccaaccgcgcgtccctggcc
gcccggctgctgctgggcaaggcctcgcccgagaccgtccagctggcgcgtcgcgccgcc
tcctcctcgcgggggatgcgggccgagcggctgctggaggagtgggtcgaggtcgtggcc
aagcgccgtgagcagctcgtggcccacgtcgtctcggcgaccccgctgaccgacgcccag
cgcgagcggctcgccgccacgctgtcgcgccagtacgggcgcgccatccgcgtcaacctc
gacgtcgacccccacctggtggggggcctgcgcgtcagcgtcggcgacgacgtcatcgac
gggtcgatctcgacccggttggacgaggcccgccgccggctcgccggctga

DBGET integrated database retrieval system