KEGG   Kineococcus radiotolerans: Krad_1268Help
Entry
Krad_1268         CDS       T00562                                 

Definition
(GenBank) ATP synthase F1, alpha subunit
  KO
K02111  F-type H+-transporting ATPase subunit alpha [EC:3.6.3.14]
Organism
kra  Kineococcus radiotolerans
Pathway
kra00190  Oxidative phosphorylation
kra01100  Metabolic pathways
Module
kra_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:kra00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Krad_1268
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:kra00194]
    Krad_1268
Enzymes [BR:kra01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.14  H+-transporting two-sector ATPase
     Krad_1268
Photosynthesis proteins [BR:kra00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   Krad_1268
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_ab ATP-synt_ab_C ATP-synt_ab_N
Motif
Other DBs
NCBI-ProteinID: ABS02756
UniProt: A6W7G7
Position
complement(973477..975135)
Genome map
AA seq 552 aa AA seqDB search
MAELTIRPEEIRDALDAFVASYDPGTAAREEVGRVTDAGDGIAHVEGLPSVMANELLRFQ
DGTLGLAQNLDVRDIGVVVLGDYAGIEEGQEVHRTGEVLSVPVGDNFLGRVVDPLGAPID
GLGPIEAETRRALELQAPSVMQRQEVREPLQTGIKAIDAMIPVGRGQRQLIIGDRQTGKS
AIAIDTIINQKANWESGDPKQQVRCIYVAIGQKGSTIAAVRRSLEEAGAMEYTTIVAAPA
SDPAGFKYLAPYTGSSIGQHWMYGGKHVLIVFDDLSKQAEAYRAVSLLLRRPPGREAYPG
DVFYLHSRLLERCAKLSDELGGGSMTGLPFIETKGNDVSAYIPTNVISITDGQIFLQSDL
FNANQRPAIDVGISVSRVGGAAQTKAIKGISGTLKLDLAQFRAMEAFAMFASDLDQASRN
QLARGARLVELLKQPQYTPFSLEEQVVSIWAGTTGQLDSVEVSDISRFEREFLEYVKRNH
AGVMQGIRETKQFSDGAKDELKKAVDAFKPQFSGGSKGSNVPKDVDAGATDADDISQEKI
TTRKGGATAARG
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atggccgagctgaccatccgcccggaggagatccgggacgctctcgacgccttcgtggcg
tcgtacgaccccggaaccgccgcgcgtgaggaagtcggccgcgtgaccgacgcgggcgac
ggcatcgcccacgtcgagggcctgccctcggtcatggcgaacgaactcctccgcttccag
gacgggaccctgggcctggcccagaacctcgacgtccgcgacatcggcgtcgtcgtcctc
ggcgactacgccggcatcgaggagggccaggaggtgcaccgcaccggggaggtcctctcc
gtgccggtcggtgacaacttcctgggccgcgtcgtcgacccgctgggcgcgcccatcgac
ggcctcgggccgatcgaggccgagacccgccgcgccctggagctgcaggccccctcggtc
atgcagcgccaggaggtccgcgagccgctgcagaccggcatcaaggccatcgacgccatg
atccccgtcggccgcggccagcgtcagctgatcatcggcgaccgccagaccggcaagagc
gccatcgcgatcgacacgatcatcaaccagaaggccaactgggagagcggcgacccgaag
cagcaggtccgctgcatctacgtcgccatcggccagaagggctcgaccatcgccgcggtg
cgtcgcagcctcgaggaggccggcgcgatggagtacacgaccatcgtcgccgcccccgcg
tccgacccggccggcttcaagtacctggccccctacaccggctcctccatcgggcagcac
tggatgtacggcggcaagcacgtcctcatcgtgttcgacgacctgtcgaagcaggccgag
gcctaccgcgccgtgtcgctgctgctgcgtcgtccgccgggccgcgaggcctaccccggt
gacgtcttctacctgcactcccgcctgctggagcgctgcgcgaagctgtccgacgagctc
ggcggcgggtcgatgacgggtctgccgttcatcgagaccaagggcaacgacgtctcggcg
tacatcccgaccaacgtcatctccatcaccgacggccagatcttcctccagtcggacctc
ttcaacgccaaccagcgtcccgccatcgacgtcggcatctcggtgtcccgcgtcggcggc
gccgcgcagacgaaggccatcaaggggatctccggcacgctgaagctggacctggcccag
ttccgggcgatggaggcgttcgcgatgttcgcctccgacctcgaccaggcctcgcgcaac
cagctcgcccgcggcgcgcgcctcgtggagctgctcaagcagccgcagtacacgccgttc
tccctcgaggagcaggtcgtctcgatctgggccggtaccaccggtcagctcgactccgtc
gaggtgagcgacatctcccgcttcgagcgcgagttcctcgagtacgtcaagcgcaaccac
gccggcgtcatgcagggcatccgcgagacgaagcagttctccgacggggccaaggacgag
ctgaagaaggccgtcgacgcgttcaagccgcagttctccggcggttcgaagggctcgaac
gtgccgaaggacgtcgacgcgggcgcgaccgacgccgacgacatctcgcaggagaagatc
accacccgcaagggcggggccacggccgctcgcggctga

DBGET integrated database retrieval system