KEGG   Kineococcus radiotolerans: Krad_1270Help
Entry
Krad_1270         CDS       T00562                                 

Definition
(GenBank) ATP synthase F1, beta subunit
  KO
K02112  F-type H+-transporting ATPase subunit beta [EC:3.6.3.14]
Organism
kra  Kineococcus radiotolerans
Pathway
kra00190  Oxidative phosphorylation
kra01100  Metabolic pathways
Module
kra_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:kra00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Krad_1270
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:kra00194]
    Krad_1270
Enzymes [BR:kra01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.14  H+-transporting two-sector ATPase
     Krad_1270
Photosynthesis proteins [BR:kra00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   Krad_1270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_ab ATP-synt_ab_N AAA_19 RsgA_GTPase AAA ATPase_2 ATPase NACHT AAA_16 ABC_tran NB-ARC
Motif
Other DBs
NCBI-ProteinID: ABS02758
UniProt: A6W7G9
Position
complement(970989..972449)
Genome map
AA seq 486 aa AA seqDB search
MTATVNEAPASTSKGATGRIARVIGPVVDVEFSADTMPDQNNALTTQVTMGGTTQTVTLE
VASHLGDNMVRAISLKPTDGMVRGAAVVDTGAPISVPVGNATLGHVFNAIGECLNLEEGE
QLEVHERWPIHRKAPNFDQLESRTTMFETGIKVIDLLTPYVQGGKIGLFGGAGVGKTVLI
QEMIQRVAQNHGGVSVFAGVGERTREGNDLIGEMAEAGVFDKTALVFGQMDEPPGTRLRV
ALSALTMAEYFRDVQNQDVLLFIDNIFRFTQAGSEVSTLLGRMPSAVGYQPTLADEMGVL
QERITSTRGHSITSLQAIYVPADDYTDPAPATTFAHLDATTELSREIASRGLYPAVDPLT
STSRILDPLYIAQDHYDTAVRVKQILQRNKELQDIIAILGVDELSEEDKLTVSRARRIQQ
FLSQNTYMAEKFTGVEGSTVPLKETIEGFSKIADGELDHVAEQAFFNVGGLEDVERNWAR
IQKETA
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccaccgtcaacgaagcgccggccagcaccagcaagggtgcgacaggccgcatc
gcccgagtcatcggccccgtcgtcgacgtcgagttctcggccgacacgatgccggaccag
aacaacgccctcaccacccaggtgaccatgggtggcaccacccagaccgtgaccctcgag
gtggcctcccacctcggcgacaacatggtccgtgccatctccctgaagccgaccgacggc
atggtccgcggcgcggccgtcgtcgacaccggcgccccgatctcggtgcccgtcggcaac
gcgaccctgggtcacgtcttcaacgccatcggcgagtgcctcaacctcgaggagggtgag
cagctcgaggtccacgagcgctggcccatccaccgcaaggccccgaacttcgaccagctc
gagtcgcggaccacgatgttcgagaccggcatcaaggtcatcgacctgctgaccccgtac
gtccagggcgggaagatcggcctcttcggcggtgcgggcgtcggcaagaccgtcctcatc
caggagatgatccagcgcgtcgcccagaaccacggcggtgtgtcggtgttcgccggggtc
ggcgagcgcacccgtgagggcaacgacctcatcggcgagatggccgaggccggcgtcttc
gacaagacggccctcgtcttcggccagatggacgagccgccgggcacccgcctgcgcgtg
gccctgtccgcgctgaccatggcggagtacttccgcgacgtgcagaaccaggacgtgctg
ctcttcatcgacaacatcttccggttcacccaggccggttcggaggtgtcgaccctgctg
ggccgcatgccctccgccgtggggtaccagccgacgctggccgacgagatgggcgtcctc
caggagcgcatcacctcgacccgcggtcactcgatcacctcgctgcaggcgatctacgtc
cccgccgacgactacaccgacccggcgccggccacgacgttcgcgcacctcgacgcgacg
acggagctctcccgcgagatcgcctcgcgcggtctgtacccggctgtggacccgctgacc
tcgacgtcgcgcatcctggacccgctgtacatcgcgcaggaccactacgacaccgcggtc
cgcgtcaagcagatcctgcagcgcaacaaggagctgcaggacatcatcgccatcctcggt
gtcgacgagctgtcggaggaggacaagctgacggtgagccgtgctcgccgcatccagcag
ttcctctcgcagaacacctacatggcggagaagttcaccggcgtcgagggctcgacggtc
ccgctcaaggagaccatcgagggcttctccaagatcgccgacggcgagctcgaccacgtc
gccgagcaggccttcttcaacgtcggtggcctcgaggacgtcgagcgcaactgggctcgc
atccagaaggaaaccgcctga

DBGET integrated database retrieval system