KEGG   Kineococcus radiotolerans: Krad_1275Help
Entry
Krad_1275         CDS       T00562                                 

Definition
(GenBank) protein of unknown function DUF91
  KO
K07503  endonuclease [EC:3.1.-.-]
Organism
kra  Kineococcus radiotolerans
Brite
KEGG Orthology (KO) [BR:kra00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Krad_1275
Enzymes [BR:kra01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     Krad_1275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NucS UPF0102 DnaB_C
Motif
Other DBs
NCBI-ProteinID: ABS02763
UniProt: A6W7H4
Position
968526..969221
Genome map
AA seq 231 aa AA seqDB search
MRLVIARCSVDYAGRLAAHLPLATRLLLVKADGSVLVHSDGGSYKPLNWMSPPARLTVAV
PDEDAREAGVTETWTVQHTKTDDRLVVSIHEVLHDSEHELGVDPGLVKDGVEAHLQKLLA
DNITTLGAGYTLVRREFMTAIGPVDILARDGDGAAVAVEIKRRGEIDGVEQLTRYLELMN
RDPLLTPVTGVFAAQEIKPQARTLATDRGIRCVVLDYDALRGIDDVDARLF
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtctcgtcatcgcccgctgctccgtcgactacgcgggccggctcgccgcccacctg
cccctggccacccggctgctgctggtgaaggccgacggcagcgtcctggtccactccgac
ggcggctcctacaagccgctgaactggatgagcccgccggcccgcctcaccgtcgcggtg
cccgacgaggacgcgcgcgaggcgggcgtcaccgagacgtggacggtgcagcacaccaag
accgacgaccggctcgtggtctcgatccacgaggtcctgcacgacagcgagcacgagctc
ggcgtggaccccgggctggtgaaggacggtgtcgaggcgcacctgcagaagctgctggcc
gacaacatcacgacgctgggcgcgggctacaccctcgtccgccgcgagttcatgaccgcg
atcgggccggtggacatcctggcccgcgacggcgacggggccgcggtggccgtggagatc
aagcggcgcggggagatcgacggcgtcgagcagctcacccgctacctggagctgatgaac
cgcgacccgctgctgacccccgtgacgggggtgttcgcggcgcaggagatcaagccgcag
gcccgcacgctggcgaccgaccgcggcatccggtgcgtcgtgctggactacgacgccctg
aggggcatcgacgacgtggacgcccggctgttctga

DBGET integrated database retrieval system