KEGG   Kineococcus radiotolerans: Krad_1280Help
Entry
Krad_1280         CDS       T00562                                 

Definition
(GenBank) protein of unknown function DUF77
Organism
kra  Kineococcus radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiamine_BP Ykof
Motif
Other DBs
NCBI-ProteinID: ABS02768
UniProt: A6W7H9
Position
complement(964673..964948)
Genome map
AA seq 91 aa AA seqDB search
MSAAVADAVLVVRSSGLPHRTDSMFTTVEGDWHECMEVVRRACEAVGRHGPRVSLVLKAD
IRPGRTGEMTAKLDRLEAAVERAEGEAGRGQ
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgccgccgtggccgacgccgtcctcgtcgtgcgctcctccggcctgccgcaccgc
accgactcgatgttcaccaccgtcgagggggactggcacgagtgcatggaggtggtgcgc
cgggcctgcgaggccgtggggcggcacgggccgcgggtgtcgctggtgctcaaggccgac
atccgccccgggcgcacgggggagatgacggcgaagctggaccgcctcgaggcggccgtg
gagcgcgccgagggggaggccgggcggggtcagtga

DBGET integrated database retrieval system