KEGG   Kineococcus radiotolerans: Krad_1284Help
Entry
Krad_1284         CDS       T00562                                 

Definition
(GenBank) beta-lactamase
Organism
kra  Kineococcus radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: ABS02772
UniProt: A6W7I3
Position
complement(958020..959408)
Genome map
AA seq 462 aa AA seqDB search
MSTEATPSPVPGPLPRTSPSAQGVDARGISAFLDALEAAPDVEPHSVQVLRHGAVVAEGW
WAPYAPQRPHLLYSLSKSFTSTALGFAVEEGLVDLDATVVSYFPEFDAEVTDDRARRILV
RHVAAMASGHREETLGRALEHPSGDVVRGFLQLRPDAEPGTLFCYNQPCTFALSAIVQRR
SGQGLLEYLRPRLLDPLGIDAGDIGWLRDGQDRELGWSGFHAPTEAVAKLGQLYLQRGVW
NGERLLPEAWVEEATRSHVDNASFNDNPDWQQGYGFQFWVARHGYRGDGAYGQFCVVLPE
QDAVVAVTSQSPDMQAVLDAAWEHLLPALGDPELPADPGPAEAELAQRLSQLALPPAAAG
DLPVGEFTAAAGSEPASLTRVVVEGGEVVLHDSGDELRAAVGAGEWAVTGPLAVSAGAGG
LEVVFLETPHRLHLTLRGGEFRGTWATTPLHGPPLRTLRRPV
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaccgaagccaccccgtcccccgtccccggcccgctgccccggacgagcccctcg
gcccagggggtcgacgcccgcgggatctccgcgttcctcgacgccctggaggccgccccg
gacgtcgaaccccacagcgtgcaggtcctgcgccacggggccgtcgtcgccgaggggtgg
tgggcgccctacgcgccgcagcgcccgcacctgctctactccctcagcaagagcttcacc
tcgaccgcgctggggttcgcggtcgaggagggtctggtggacctcgacgcgacggtggtg
tcgtacttccccgagttcgacgccgaggtgaccgacgaccgggcccggcgcatcctcgtc
cgccacgtggcggccatggccagcgggcaccgcgaggagaccctcggccgggccctggag
cacccctcgggcgacgtcgtgcggggtttcctgcagctccgtcccgacgcggaacccggc
accctgttctgctacaaccagccctgcaccttcgccctctcggcgatcgtccagcggcgg
tccggccaggggctgctggagtacctgcgcccgcgcctgctcgacccgctggggatcgac
gccggcgacatcggctggctgcgcgacgggcaggaccgcgagctggggtggtccggcttc
cacgcccccaccgaggccgtcgcgaagctggggcagctgtacctgcagcgcggggtctgg
aacggggaacggctgctgccggaggcctgggtcgaggaggccacccgctcccacgtcgac
aacgcctcgttcaacgacaaccccgactggcagcagggctacgggttccagttctgggtg
gcccgccacggctaccgcggcgacggcgcctacggccagttctgcgtggtcctgcccgag
caggacgccgtcgtggcggtcacctcgcagagcccggacatgcaggccgtcctggacgcg
gcgtgggagcacctgctgcccgcgctgggcgatcccgagctgccggccgaccccggcccg
gccgaagccgaactggcgcagcggttgtcgcagctcgccctgccgcccgccgcggcgggg
gacctgccggtgggggagttcaccgccgccgccggcagcgagcccgcctcgctgacgcgg
gtggtggtcgagggcggcgaggtcgtgctgcacgactccggcgacgagctgcgcgcggcg
gtcggcgcgggggagtgggcggtgaccgggcccctggctgtcagcgccggcgcgggcggc
ctggaggtcgtgttcctggaaaccccgcaccgcctgcacctgaccctgcgcggcggggag
ttccgcggcacgtgggcgaccaccccgctgcacgggccgccgctgcgcaccctgcgccgg
cccgtctga

DBGET integrated database retrieval system