KEGG   Kineococcus radiotolerans: Krad_1288Help
Entry
Krad_1288         CDS       T00562                                 

Definition
(GenBank) cysteine dioxygenase type I
Organism
kra  Kineococcus radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CDO_I RCC1_2
Motif
Other DBs
NCBI-ProteinID: ABS02776
UniProt: A6W7I7
Position
complement(954003..954563)
Genome map
AA seq 186 aa AA seqDB search
MTLAPDAPGALGAPGAPGAPAGPPAGLPPAPGRTLTPRELKDWVDEAARRPGAWEHLVRH
DTGGRHYASLHRDGDLDVWLLCWNTDDDTGWHDHDTSSGAVAVTRGAVVEANPRMGGEPA
VRTVAAGRSFAFGPDHIHRMSGAVDGSVSIHAYSPPLWRMGQYSISPSGVMRRMSVSYAD
ELRPLD
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgaccctcgcccccgacgcccccggagctctcggagcgcccggcgcccccggcgccccg
gccggcccgcccgccgggctgccccccgcgcccgggcgcaccctcaccccgcgcgagctg
aaggactgggtcgacgaggccgcccgccggcccggggcgtgggagcacctcgtccgccac
gacaccgggggacgccactacgcctccctgcaccgcgacggcgacctcgacgtgtggctg
ctgtgctggaacaccgacgacgacaccggctggcacgaccacgacacctcctccggcgcg
gtcgccgtcacccgcggcgccgtcgtcgaggccaacccccgcatgggcggggaacccgcc
gtccgcaccgtcgccgccgggcggtccttcgccttcggccccgaccacatccaccggatg
tccggagccgtcgacggctcggtgtccatccacgcctactccccgccgctgtggcggatg
ggccagtactcgatcagcccctccggggtgatgcgccggatgtcggtcagctacgccgac
gagctgcgccccctggactga

DBGET integrated database retrieval system