KEGG   Kineococcus radiotolerans: Krad_1289Help
Entry
Krad_1289         CDS       T00562                                 

Definition
(GenBank) phenylalanine/histidine ammonia-lyase
  KO
K01745  histidine ammonia-lyase [EC:4.3.1.3]
Organism
kra  Kineococcus radiotolerans
Pathway
kra00340  Histidine metabolism
kra01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kra00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    Krad_1289
Enzymes [BR:kra01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.3  histidine ammonia-lyase
     Krad_1289
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyase_aromatic
Motif
Other DBs
NCBI-ProteinID: ABS02777
UniProt: A6W7I8
Position
952494..953987
Genome map
AA seq 497 aa AA seqDB search
MQHEDAPGATRGVRVEGRGLGLDDLTDLALGRAHAVVDRDVLGRLGVLHEAMGAARERGA
VYGATTGVGANKDVEVDDEQHEHPQAHGLRLLRSHAASLGPVEDEATTRAALVVRLNQLL
AGAHAGLGAGISPPVLRALAEAVESGALPTLHRFGGIGTSDLAPLAELGLTLVGERPWRR
GAVAPVPLGAADALPLISSHALTLATASLALCRLRQLLLAGTGISALSFLALRGNPQAWA
PPVHAARAHPAQTGLAATLHALVAGGPEPARLQDPFALRTAPQVLAPAFTAAQALEDVLA
LEASTPGENPLVSPEGVFHHGQFHAASLATALDTLRATTFGVLTLSAARLALLLRPEHTG
LRAFLAAGPRGSSGLMIGEYVVQDVLAELRPATAPSTSGTVSISLGLEEHASFATQGARA
LRQTAELAPVVLAVEALAAVRALRAAPDRMSPGAAALFAVFDEVLGRDSRDAPIGPDVEA
VVARVVDLSLLVRVPPV
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
gtgcagcacgaggacgccccgggcgcgactcgcggggtgcgggtcgagggtcgcggcctc
gggctggacgacctcaccgacctcgccctgggccgcgcgcacgcggtcgtcgaccgcgac
gtgctgggccgtctcggcgtgctgcacgaggcgatgggcgccgcccgcgagcgcggcgcg
gtctacggcgcgacgaccggggtgggcgccaacaaggacgtcgaggtcgacgacgagcag
cacgagcacccgcaggcccacgggctgcggctgctgcgcagccacgcggcgtcgctgggc
ccggtggaggacgaggcgacgacccgcgcggcgctggtggtgcggctgaaccagctgctg
gccggcgcgcacgcgggcctgggggcggggatcagcccgccggtcctgcgcgccctggcc
gaggcggtggagtccggggcgctgccgacgctgcaccgcttcggcggcatcgggacctcg
gacctggcgccgctggcggagctggggctgaccctcgtcggggagcggccgtggcggcgc
ggggcggtggcgcccgtgccgctgggcgccgccgacgcgctgccgctcatcagctcccac
gccctgacgctggcgacggcgtcgctggccctgtgccggttgcggcagctgctgctggcg
gggacggggatctcggcgctgtcgttcctggcgctgcgcggcaacccgcaggcgtgggcg
ccgcccgtgcacgccgcccgcgcccaccccgcccagaccgggctggccgcgacgctgcac
gcgctggtggccggcggcccggaacccgcgcggttgcaggacccgttcgcgctgcggacc
gcgccgcaggtgctggcccccgccttcaccgcggcgcaggccctggaggacgtgctggcg
ctggaggcctcgacgcccggggagaacccgctggtctcccccgagggggtcttccaccac
ggccagttccacgccgcgtccctggccaccgccctggacacgttgcgggcgaccaccttc
ggggtgctgacgctgtccgcggcccgcctcgcgctgctgctgcgcccggagcacaccggg
ttgcgggcgttcctggccgccggtccgcgcgggagctcgggcctgatgatcggcgagtac
gtcgtgcaggacgtgctggccgagctgcgcccggcgacggccccctccacgtcggggacg
gtcagcatctccctcggcctggaggagcacgcgagcttcgcgacccagggggcgcgcgcg
ctgcgccagaccgcggagctggcgccggtggtgctggccgtcgaggcgctggccgcggtg
cgcgcgctgcgggccgcgccggaccggatgtcgcccggggcggcggcgctgttcgcggtc
ttcgacgaggtgctcggccgcgactcccgcgacgcgcccatcggcccggacgtggaggcg
gtggtggcgcgggtggtggacctgtcgctgttggtgcgggtcccgccggtctga

DBGET integrated database retrieval system