KEGG   Kineococcus radiotolerans: Krad_1292Help
Entry
Krad_1292         CDS       T00562                                 

Definition
(GenBank) binding-protein-dependent transport systems inner membrane component
  KO
K05846  osmoprotectant transport system permease protein
Organism
kra  Kineococcus radiotolerans
Pathway
kra02010  ABC transporters
Module
kra_M00209  Osmoprotectant transport system
Brite
KEGG Orthology (KO) [BR:kra00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Krad_1292
Transporters [BR:kra02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Osmoprotectant transporter [MD:M00209]
    Krad_1292
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ABS02780
UniProt: A6W7J1
Position
complement(949922..950677)
Genome map
AA seq 251 aa AA seqDB search
MDGTPYLLDPAHWDWGTTGSIPHLLVSHLGYTAISVAVGFLIAFPIGLLIGHTGKGSFLA
INAGNAGRSLPTLGLLSLLVTLMGLGFVPVLIALVVLVIPPILTSTYAGLRSVDRNAVDA
ARGMGMTSSQVLFRVELPMALPVVFGGVRAAVLQVVATATVAAYVGLSGLGRLLVDGLAV
NDYGRVVAGAVVVAALAIVLDLLLGLVQRYVVSPGISGRGRSRAGRRGSVAESPVEPDTE
LIGAGTSKGTS
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
gtggacggcaccccgtacctgctcgaccccgcccactgggactgggggaccaccggctcc
atcccgcacctgctggtgtcgcacctgggctacaccgcgatctcggtggccgtgggcttc
ctcatcgccttcccgatcggcctgctcatcggccacaccggcaaggggtccttcctggcc
atcaacgccggcaacgccgggcgctcgctgcccacgctgggcctgctgagcctgctcgtg
acgctcatggggctcgggttcgtccccgtcctcatcgccctcgtcgtgctcgtcatcccc
ccgatcctcacctccacctacgccgggctgcgctcggtggaccgcaacgccgtcgacgcg
gcccgggggatgggcatgacctcctcccaggtcctcttccgcgtcgagctgcccatggcg
ctgcccgtcgtcttcggcggggtccgcgccgcggtgctgcaggtcgtggcgaccgcgacg
gtcgccgcctacgtcggcctctccgggctgggtcgcctcctcgtcgacggcctcgccgtc
aacgactacggccgcgtcgtcgccggggccgtcgtggtcgcggcgctggccatcgtcctc
gacctgctgctgggcctggtccagcgctacgtcgtctccccgggcatcagcggccgcggc
cgctcccgcgcggggcgccgcggatccgtggcagagtcccccgttgaacccgacaccgaa
ctcatcggtgcaggcacgtcgaaaggcacgtcatga

DBGET integrated database retrieval system