KEGG   Kineococcus radiotolerans: Krad_1293Help
Entry
Krad_1293         CDS       T00562                                 

Definition
(GenBank) Substrate-binding region of ABC-type glycine betaine transport system
  KO
K05845  osmoprotectant transport system substrate-binding protein
Organism
kra  Kineococcus radiotolerans
Pathway
kra02010  ABC transporters
Module
kra_M00209  Osmoprotectant transport system
Brite
KEGG Orthology (KO) [BR:kra00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Krad_1293
Transporters [BR:kra02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Osmoprotectant transporter [MD:M00209]
    Krad_1293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OpuAC RPN13_C DUF2344 CytB6-F_Fe-S
Motif
Other DBs
NCBI-ProteinID: ABS02781
UniProt: A6W7J2
Position
complement(948990..949925)
Genome map
AA seq 311 aa AA seqDB search
MNRRSLLGLALAGSLTAALTACGGGEDPLAATDTSTGAATDTAAVIVGSANFPESELLAE
MYAQVLEKSGVEVQRKFNIGAREVYLKALQDGSIDLLPEYNGALLAALSDGGAPEGVSAP
EDVLGALKEVLPEGTEVLEQSAAEDKDTLSVTAETASKYSLKTIEDLAPVAGELVCGAGP
EFQERYQGLVGLKELYGVQFKEFRPLDAGGPLTVGALADGTIQVGNIFSTDSAITTNGFV
VLEDTKQLFLAENILPLIRSEKNTPEITEALDGLSAKLTTENLTKFLAQVQVDKKSSAAV
ATAFLTELGLA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgcaggtcactcctcggtctcgccctcgcgggctccctcaccgctgcgctgacc
gcctgcggtggcggggaggacccgctggccgccaccgacacctcgacgggggccgccacc
gacaccgccgccgtcatcgtcggctcggccaacttccccgagagcgaactgctcgcggag
atgtacgcccaggtgctggagaagtccggtgtcgaggtccagcggaagttcaacatcggc
gcccgcgaggtgtacctcaaggccctccaggacggctccatcgacctgctgccggagtac
aacggcgcgctgctcgccgccctgtccgacggcggcgcccccgagggcgtctcggccccc
gaggacgtcctcggggcgctgaaggaggtcctgccggaggggaccgaggtcctcgagcag
tccgccgccgaggacaaggacaccctttccgtgaccgcggagacggcgtcgaagtacagc
ctgaagaccatcgaggacctcgcgccggtggccggcgagctggtctgcggcgccggcccg
gagttccaggagcggtaccagggcctcgtggggctcaaggagctctacggcgtgcagttc
aaggagttccgcccgctggacgccggcggcccgctgaccgtcggggcgctggccgacggc
accatccaggtcggcaacatcttctccaccgactccgccatcacgacgaacggcttcgtc
gtcctggaggacaccaagcagctgttcctggcggagaacatcctcccgctcatccggtcc
gagaagaacacccccgagatcaccgaggccctcgacggcctgtcggcgaagctgacgacg
gagaacctcacgaagttcctggcccaggtgcaggtggacaagaagtcctcggcggccgtc
gccacggcgttcctgaccgagctcggcctggcctga

DBGET integrated database retrieval system