KEGG   Kineococcus radiotolerans: Krad_1300Help
Entry
Krad_1300         CDS       T00562                                 

Definition
(GenBank) transcriptional regulator, TetR family
Organism
kra  Kineococcus radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TetR_N Ion_trans_N
Motif
Other DBs
NCBI-ProteinID: ABS02788
UniProt: A6W7J9
Position
complement(937025..937591)
Genome map
AA seq 188 aa AA seqDB search
MLRLVAEHVLAHGVTSLTLRGLARAVGSNNRMLLYYFGSKEQLVGEALRAVGRDAFPSFE
NAWAALENGDGDLRADLQRVWDQIAAPGNLPFLRLFFEVFGQASQQAGYADLLGDIGSWQ
GPAVARFQREGMTPALAEARAVELTALWRGLQMTLIITGDAAAVGRVQAQALEAFCARVG
EVTPPRVL
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
ttgctgcggctggtggcggagcacgtcctggcccacggcgtcacgtcgctgacgctgcgc
gggctggcccgggccgtgggttccaacaaccgcatgctgttgtactacttcggcagcaag
gaacagctggtgggggaggccctgcgggccgtcggccgcgacgcgttcccctcgttcgag
aacgcctgggccgcgctggagaacggcgacggcgacctgcgcgcggacctgcagcgggtc
tgggaccagatcgccgccccgggcaacctgccgttcctgcggttgttcttcgaggtcttc
ggccaggcttcccagcaggccgggtacgcggacctgctcggagacatcgggtcctggcag
ggcccggccgtcgcgcggttccagcgcgaggggatgacccccgcgctggccgaggcccgc
gcggtggagctcaccgcgttgtggcgggggttgcagatgacgctcatcatcaccggggac
gccgccgcggtggggcgggtgcaggcgcaggccctggaggcgttctgcgcccgcgtcggg
gaggtcacgcccccgcgggttctctga

DBGET integrated database retrieval system