KEGG   Kineococcus radiotolerans: Krad_1303Help
Entry
Krad_1303         CDS       T00562                                 

Definition
(GenBank) ABC transporter related
  KO
K02049  NitT/TauT family transport system ATP-binding protein
Organism
kra  Kineococcus radiotolerans
Module
kra_M00188  NitT/TauT family transport system
Brite
Transporters [BR:kra02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   NitT/TauT family transporter [MD:M00188]
    Krad_1303
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran Rad17 AAA_21 AAA_16 AAA_5 AAA_22 AAA_29 RsgA_GTPase AAA_30 G-alpha AAA AAA_28 AAA_18
Motif
Other DBs
NCBI-ProteinID: ABS02791
UniProt: A6W7K2
Position
complement(933332..934231)
Genome map
AA seq 299 aa AA seqDB search
MPHDTSSLSTAPGPPVTVPATVSATVSATTDPRRHPGAATGFNLQGLTKRFDLGRKSVLA
LEQTDLGTRKNAFLSLLGPSGCGKSTILRILAGLETPTGGAALVNGMTTRELQRAHELGV
AFQDSALLPWRTVAQNIRLPLEVAGVRPEKGLVDDLIGLVGLKGFEKAKPAQLSGGMRQR
VSIARCLVVQPTVMLLDEPFGALDDMTRQRLNVELLRIWTEKPATTLMVTHGISEAIFLS
DVVAVMSPRPGRVVEVVEIDLPRPRTPDMMRTPEFHAYHDRLSEILFGGGTSRAEDDHR
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
gtgccgcacgacacctcgtccctctccaccgccccgggcccgccggtcacggtcccggcc
acggtctccgccacggtctcggccacgaccgatccccggcgccaccccggggcggccacg
ggcttcaacctccagggcctcaccaagcgcttcgacctgggccgcaagagcgtgctcgcg
ctggagcagaccgacctgggcacccggaagaacgccttcctctcgctgctggggccctcg
ggctgcgggaagtcgacgatcctgcgcatcctcgccggtctggagacccccacggggggc
gcggcgctggtcaacggcatgacgaccagggagctgcagcgcgcccacgagctcggcgtc
gcgttccaggactccgcgctgctgccgtggcgcacggtggcccagaacatccggctcccc
ctcgaggtcgccggggtgcgcccggagaaggggctcgtcgacgacctcatcggtctcgtc
gggctgaagggcttcgagaaggcgaagccggcccagctctccggcggcatgcgtcagcgc
gtctccatcgcgcgctgcctcgtggtgcagcccaccgtcatgctcctggacgagccgttc
ggcgcgctggacgacatgacccgtcagcgcctgaacgtcgagctgctgcgcatctggacc
gagaagccggccaccacgctcatggtgacccacgggatctccgaggcgatcttcctctcc
gacgtcgtcgccgtcatgagcccccgcccgggccgggtcgtggaggtcgtcgagatcgac
ctcccgcgcccgcgcacgccggacatgatgcgcaccccggagttccacgcctaccacgac
cggctctcggagatcctgttcggcggcggcacgtcccgggcggaggacgaccaccgatga

DBGET integrated database retrieval system