KEGG   Kineococcus radiotolerans: Krad_1361Help
Entry
Krad_1361         CDS       T00562                                 

Definition
(GenBank) EPSP synthase (3-phosphoshikimate 1-carboxyvinyltransferase)
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
kra  Kineococcus radiotolerans
Pathway
kra00520  Amino sugar and nucleotide sugar metabolism
kra00550  Peptidoglycan biosynthesis
kra01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kra00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Krad_1361
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Krad_1361
Enzymes [BR:kra01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Krad_1361
Peptidoglycan biosynthesis and degradation proteins [BR:kra01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   Krad_1361
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase HTH_3 HTH_31 HTH_19 HTH_37 HTH_24 HTH_26 YdaS_antitoxin Sigma70_r4 HTH_IclR MarR_2 HTH_25 HTH_AsnC-type MarR
Motif
Other DBs
NCBI-ProteinID: ABS02849
UniProt: A6W7R0
Position
864135..865685
Genome map
AA seq 516 aa AA seqDB search
MAVSTEQMTPSSDHLSQIGALIRDARKHRGLTQVQLAERLGTSQSAVHRMEQGQQNVSID
MLQRVGHALQDDIVSIGRPSPTHLRVHGGVKLSGSIAVKSSKNAGVALLCAALLNKGRTT
LRGVARILEIHRILDVLASIGVRYEWVNEADLVLDVPTELDLDAMDGETARRTRSIIMML
GPLLHRYDEFALPYAGGCDLGTRTVEPHMVALRPFGLSITATTGYYHATVDQTVSPQRPI
VLTERGDTVTENALMAAARVEGVTTIRNASPNYMVQDLCFFLEQLGVRIDGIGTTTLVVH
GVKDISVDVDYAPSEDPVEAMSLLTAAIITHSELTVTRAPIEFLEIELAILSEMGLEYDL
TPEYTAANGRTRLVDITVHPSELKAPIDKIHPMPFPGLNIDNLPFFAVIAASAEGSTTVH
DWVYDNRAIYLTELNRLGARVKLLDPHRVLVEGPTRWSGAEVLCPPALRPAVVVLLAMLA
AKGTSVLRNVDIIARGYEQLAERLTPLGAQIETFRD
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atggcagtctccaccgagcagatgacgcccagcagcgaccacctgtcgcagatcggcgcc
ctcatccgcgacgcccgcaagcaccggggtctcacccaggtccagctcgcggaacgcctg
ggcacgtcccagagcgccgtccaccgcatggaacaggggcagcagaacgtctcgatcgac
atgctgcagcgcgtcggtcacgccctccaggacgacatcgtgtccatcgggcggcccagc
ccgacgcacctgcgcgtccacggcggggtgaagctctcgggcagcatcgccgtgaagtcc
agcaagaacgccggggtggccctgctgtgcgccgcgctgctcaacaagggccgcacgacg
ttgcgcggggtggcgcggatcctggagatccaccgcatcctcgacgtgctggccagcatc
ggcgtccgctacgagtgggtcaacgaggccgacctcgtcctcgacgtgccgaccgagctg
gacctggacgcgatggacggcgagaccgcgcgccgcacccgcagcatcatcatgatgctc
ggcccgctgctgcaccgctacgacgagttcgcgctgccctacgccggcggttgcgacctc
ggcacccgcaccgtcgagccgcacatggtcgccctgcgccccttcgggttgtccatcacc
gccacgaccggctactaccacgcgacggtcgaccagaccgtgtccccgcagcgccccatc
gtcctgaccgagcgcggcgacaccgtgaccgagaacgccctcatggcggcggcccgggtc
gagggcgtcaccacgatccgcaacgccagcccgaactacatggtccaggacctctgcttc
ttcctggagcagctgggcgtgcggatcgacgggatcggcaccacgaccctcgtcgtgcac
ggcgtcaaggacatctccgtcgacgtcgactacgccccctccgaggacccggtggaggcg
atgagcctgctgaccgcggcgatcatcacccactccgagctcaccgtgacccgcgccccg
atcgagttcctcgagatcgagctggcgatcctgtccgagatgggcctggagtacgacctc
accccggagtacaccgccgcgaacgggcgcacccgcctggtggacatcacggtgcacccc
tcggagctcaaggccccgatcgacaagatccacccgatgccgttcccgggcctgaacatc
gacaacctgccgttcttcgccgtcatcgcggcgagcgcggaggggtcgaccacggtgcac
gactgggtctacgacaaccgggcgatctacctcaccgagctcaaccggctgggggcgcgg
gtgaagctgctcgacccgcaccgcgtgctggtggagggcccgacgcgctggtcgggggcg
gaggtgctctgcccgccggccctgcgcccggccgtggtggtgctgctggcgatgctggcg
gccaaggggacctccgtcctgcgcaacgtggacatcatcgcccgcggctacgagcagctg
gccgagcggctgaccccgctgggcgcgcagatcgagaccttccgcgactga

DBGET integrated database retrieval system