KEGG   Kineococcus radiotolerans: Krad_1474Help
Entry
Krad_1474         CDS       T00562                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
kra  Kineococcus radiotolerans
Pathway
kra00625  Chloroalkane and chloroalkene degradation
kra00680  Methane metabolism
kra01100  Metabolic pathways
kra01120  Microbial metabolism in diverse environments
kra01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:kra00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    Krad_1474
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Krad_1474
Enzymes [BR:kra01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     Krad_1474
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_N_assoc ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C HI0933_like FAD_binding_2 FAD_binding_3 FAD_oxidored TrkA_N
Motif
Other DBs
NCBI-ProteinID: ABS02962
UniProt: A6W823
Position
741889..743031
Genome map
AA seq 380 aa AA seqDB search
MKAVVYQGPKDVVVKEVPDARVEEPTDAVVRITTTNICGSDLHMYEGRTSVEEGKVLGHE
NTGVVEAVGSGVSRVKVGDRVSVPFNIACGSCRNCVHGWTSFCLRMNPTEGMDGAAYGYA
NMGPYDGGQAEFLRVPHADFNLLDLPAGTEHENDFTMLSDIFPTGWHGVELSGMVPGDDV
AVFGAGPVGLMAAHSALIKGASRVFVVDKAPDRLRLAASIGAVPVDFSAGDPVEQITEQT
RGRGVDRGVEAVGYQAHDPSGEEHPELVLDNLVKVVRATGGIGVVGVYMPEDPGAANEGA
KQGRIGWDYGTFFTKGQSMGTGQAPVMRYNRQLRDLIVAGRATPGFIVSHELPLEQAPEG
YRNFDDRVEGWTKVLLHPGS
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggccgtcgtctaccagggcccgaaggacgtcgtcgtgaaggaggtccccgacgcc
cgcgtcgaggaacccaccgacgccgtcgtccgcatcaccaccaccaacatctgcggttcc
gacctgcacatgtacgagggccgcacctccgtggaggagggcaaggtcctcggccacgag
aacaccggcgtcgtcgaggccgtcggctccggcgtgagccgggtgaaggtcggcgaccgc
gtgtcggtccccttcaacatcgcctgcggcagctgccgcaactgcgtgcacgggtggacc
tcgttctgcctgcggatgaaccccaccgagggcatggacggcgcggcctacggctacgcc
aacatgggcccctacgacggcgggcaggcggagttcctgcgcgtcccgcacgccgacttc
aacctgctcgacctgcccgccggcaccgagcacgagaacgacttcacgatgctctccgac
atcttccccaccggctggcacggggtggagctgtccgggatggtccccggcgacgacgtc
gccgtgttcggcgccggccccgtcggcctgatggccgcccacagcgcgctgatcaagggc
gcctcgcgggtgttcgtcgtggacaaggcccccgaccggctgcggctggccgcgagcatc
ggcgcggtcccggtcgacttctccgccggcgacccggtcgagcagatcaccgagcagacc
cgcgggcgcggggtcgaccgcggcgtggaggccgtcggctaccaggcccacgacccctcc
ggcgaggagcaccccgagctcgtcctggacaacctggtgaaggtcgtgcgcgccaccggc
ggcatcggcgtcgtgggcgtctacatgcccgaggaccccggcgcggcgaacgagggcgcg
aagcaggggcgcatcggctgggactacgggacgttcttcaccaagggccagtccatgggc
accgggcaggcgcccgtgatgcgctacaaccgccagctgcgcgacctcatcgtcgccgga
cgggccaccccgggcttcatcgtctcccacgagctcccgctggagcaggcgcccgagggg
taccgcaacttcgacgaccgcgtcgagggctggaccaaggtcctcctgcacccggggtcc
tga

DBGET integrated database retrieval system