KEGG   Kineococcus radiotolerans: Krad_1586Help
Entry
Krad_1586         CDS       T00562                                 

Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
kra  Kineococcus radiotolerans
Pathway
kra00860  Porphyrin and chlorophyll metabolism
kra01100  Metabolic pathways
kra01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kra00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Krad_1586
Enzymes [BR:kra01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Krad_1586
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     Krad_1586
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO NAD_binding_9 Thi4 HI0933_like FAD_binding_2 Pyr_redox Pyr_redox_2 GIDA FAD_oxidored Trp_halogenase
Motif
Other DBs
NCBI-ProteinID: ABS03072
UniProt: A6W8D3
Position
complement(621378..622826)
Genome map
AA seq 482 aa AA seqDB search
MAELTPAPPRPRALPHVVVVGAGISGLTAAWELTRSGEFTVEVLEAADVVGGVLQRAEVG
GVVLDVGAESMLARRPEGVDLVRDAGLADALVHPATARASVRSPGRLDPLPSGTLMGVPR
SADAVEGFLAPAEVARVRAEPDLPAPPLTEDVAVADYVAARVGQAVVDRLVEPLLGGVYA
GHAAQLSLRATVPALWQHAVRGGSLLHAIAEPPAASSAPVFAGLRGGLATLPRTLAERLR
ERGAVVATSTPVTRLERRPDGWLVDTARCSRHADAVVVAVPAPAAARLLAEPVPAAAAEL
RGVETASVVIAALAVPAGELSGLTGSGLLVPPAVAAVEGLRAKALTLSGNKWDWVGDQRG
DRPGGTAVLRVSLGRAGETEALGAEDADVVRWATADASRLLGRDLHPVEHAVVRWVDGLP
QYAVGHLDRVERLRAAVGAAGRLAVCGSVLDGVGIPACVGAARRAAAQVRAELAPAWGRM
RA
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
gtggcggagctgacccccgccccgccccgcccccgcgccctcccgcacgtggtcgtcgtg
ggggccgggatctccggcctcaccgccgcgtgggagctcacccgctccggggagttcacc
gtcgaggtcctcgaggccgccgacgtcgtcgggggcgtcctgcagcgcgccgaggtcggc
ggggtcgtcctcgacgtcggcgccgagtcgatgctcgcccgccgccccgagggcgtggac
ctggtccgcgacgccggtctcgccgacgccctcgtccaccccgccaccgcccgcgcgagc
gtccgttcccccggccgcctcgacccgctgccctcaggcaccctcatgggggtcccgcgc
tccgccgacgcggtggaggggttcctcgcccccgcggaggtggcccgcgtgcgcgccgaa
ccggacctgcccgccccgccgctgaccgaggacgtcgccgtcgccgactacgtcgccgcc
cgcgtcgggcaggccgtcgtcgaccgcctcgtcgaacccctcctcggcggggtgtacgcc
ggccacgccgcgcagctgtccctgcgcgccaccgtccccgccctgtggcagcacgccgtg
cgcggcggttccctcctgcacgccatcgccgaaccccccgccgcctccagcgcccccgtc
ttcgcgggcctgcgcggcggcctggccaccctcccgcggaccctcgccgagcggctgcgc
gagcgcggcgccgtggtcgccacctccacccccgtcacccgcctggagcgccgccccgac
ggctggctcgtcgacaccgcccgctgctcccgccacgccgacgccgtcgtcgtcgccgtg
cccgcccccgccgcggcgcggctgctggccgaacccgtccccgccgccgcggccgagctg
cgcggggtcgagaccgcgagcgtggtcatcgccgcgctcgccgtcccggcgggggagctg
tccgggctgaccggttcggggctgctcgtcccgcccgccgtcgccgcggtggagggcctg
cgcgccaaggcgctgacgctgtcggggaacaagtgggactgggtcggggaccagcgcggg
gaccggcccgggggcaccgccgtgctccgcgtctcgctgggacgcgcgggggagaccgag
gccctgggggccgaggacgccgacgtggtgcgctgggccaccgccgacgcctcccggctg
ctgggacgcgacctgcacccggtcgagcacgccgtggtgcgctgggtggacggcctgccg
cagtacgccgtgggccacctcgaccgggtcgagcggctgcgcgcggccgtcggggccgcg
ggccggctcgccgtctgcggctcggtcctggacggggtcgggatcccggcctgcgtcggg
gccgcccggcgcgcggcggcgcaggtgcgtgcggagctcgcaccggcctgggggaggatg
cgggcatga

DBGET integrated database retrieval system