KEGG   Kineococcus radiotolerans: Krad_1864Help
Entry
Krad_1864         CDS       T00562                                 

Definition
(GenBank) tryptophan 23-dioxygenase
  KO
K00453  tryptophan 2,3-dioxygenase [EC:1.13.11.11]
Organism
kra  Kineococcus radiotolerans
Pathway
kra00380  Tryptophan metabolism
kra01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kra00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    Krad_1864
Enzymes [BR:kra01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.11  tryptophan 2,3-dioxygenase
     Krad_1864
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_dioxygenase 4HB_MCP_1 BILBO1_N Hs1pro-1_C
Motif
Other DBs
NCBI-ProteinID: ABS03350
UniProt: A6W961
Position
364761..365621
Genome map
AA seq 286 aa AA seqDB search
MSGTAEENTREVEAGVVTDFTREMSYGEYLHLDELLAAQHPLSTPEHHDELLFIVQHQTS
ELWLKLVLHELRSAMRAIAADDLKTALKNIARVKHIQRTLTEQWSVLATLTPTEYAQFRG
FLANSSGFQSQQYRAVEFALGNKNAKMLDVFAHDGPGHAQLTELLEAPSLYDEFLRHLAR
RGHDVPAELLERDVTKAHVHTPALVATFRVIYEDAQRYWTEYEACEELVDLEENFQLWRF
RHLKTVERTIGFKRGTGGSSGVGFLARALDLTFFPELYAVRTEIGS
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggtacggcggaggagaacacgcgcgaggtcgaggcgggcgtcgtcaccgacttc
acccgcgagatgtcctacggggagtacctgcacctggacgagctgctcgccgcccagcac
cccctctccacccccgagcaccacgacgagctgctcttcatcgtccagcaccagaccagc
gagctgtggctcaagctcgtcctgcacgagctgcgctcggccatgcgcgccatcgccgcc
gacgacctcaagacggcgctgaagaacatcgcccgggtcaagcacatccagcgcaccctc
accgagcagtggtcggtcctggcgaccctgactcccaccgagtacgcgcagttccgcggc
ttcctggccaactcctccggcttccagagccagcagtaccgcgccgtggagttcgccctg
ggcaacaagaacgcgaagatgctggacgtcttcgcccacgacgggcccgggcacgcgcag
ctgacggagctgctggaggcccccagcctctacgacgagttcctgcgccacctggcccgg
cgcgggcacgacgtcccggccgagctgctggagcgcgacgtcaccaaggcccacgtccac
acccccgccctcgtcgccacgttccgcgtcatctacgaggacgcccagcgctactggacc
gagtacgaggcctgcgaggagctcgtcgacctggaggagaacttccagctctggcgcttc
cgccacctcaagaccgtcgagcgcaccatcggcttcaagcgcggcaccggcggctcctcc
ggggtgggcttcctggcccgggccctggacctcaccttcttccccgagctgtacgccgtg
cgcaccgagatcggctcgtga

DBGET integrated database retrieval system