KEGG   Kineococcus radiotolerans: Krad_2965Help
Entry
Krad_2965         CDS       T00562                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
kra  Kineococcus radiotolerans
Pathway
kra00260  Glycine, serine and threonine metabolism
kra00400  Phenylalanine, tyrosine and tryptophan biosynthesis
kra01100  Metabolic pathways
kra01110  Biosynthesis of secondary metabolites
kra01130  Biosynthesis of antibiotics
kra01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:kra00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Krad_2965
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Krad_2965
Enzymes [BR:kra01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Krad_2965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABS04429
UniProt: A6WC90
Position
4033140..4034441
Genome map
AA seq 433 aa AA seqDB search
MTTTPAQPETPGYTFSQERGPYFGRFGGRFVPEALIAALDEIAAAHEAAMADEGFLAELA
ELHRSYSGRPSILTEVPRFAAHAGGARIVLKREDLNHTGSHKINNVLGQALLTKRMGKNR
IIAETGAGQHGVATATAAALMGLECTVYMGEEDTRRQALNVARMRLLGATVVPVTAGSRT
LKDAVNEAFRDWVASVDTTHYAFGTVAGPHPFPVLVRDLQRIVGVEARQQVLDLVGRLPD
AVAACVGGGSNAIGIFHGFLDDPSVALHGYEAGGDGVETGRHAAPISAGVTGVFQGARQF
VMQDEDGQTIESHSISAGLDYPGVGPEHAWLAASGRASYHPVTDAQAMDAFRLLCRTEGI
IPAIESSHALAGALDLGRELGPDAVILVSLSGRGDKDVDTAARWFGLVSDADLVASEAER
VADVPENTEGSGW
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
gtgaccacgacccccgcgcagccggagacccccgggtacaccttcagccaggagcgcggc
ccctacttcggccgcttcggtggccggttcgtgcccgaggccctgatcgccgccctcgac
gagatcgcggccgcgcacgaggccgcgatggccgacgagggcttcctcgccgagctcgcc
gagctgcaccgcagctactccgggcgcccgagcatcctcaccgaggtgccgcgcttcgcc
gcccacgccggcggggcccggatcgtcctcaagcgcgaggacctgaaccacaccggctcg
cacaagatcaacaacgtgctcggccaggcgctgctcaccaagcggatgggcaagaaccgc
atcatcgccgagaccggcgccggccagcacggggtggccaccgccacggcggccgcgctc
atgggcctggagtgcacggtctacatgggcgaggaggacacccggcggcaggcgctgaac
gtcgcccggatgcgcctgctcggggccacggtcgtcccggtgaccgcgggcagccggacg
ctgaaggacgccgtcaacgaggccttccgcgactgggtcgcctccgtcgacaccacccac
tacgccttcgggacggtcgcgggcccgcaccccttccccgtcctggtccgcgacctgcag
cgcatcgtcggcgtcgaggcccgccagcaggtcctcgacctcgtcgggcgcctgcccgac
gccgtcgccgcctgcgtgggcgggggctccaacgccatcggcatcttccacggcttcctc
gacgacccctccgtcgcgctgcacggctacgaggccggcggcgacggggtggagaccggg
cgccacgccgcgcccatctcggccggggtcaccggcgtcttccagggcgcgcgccagttc
gtcatgcaggacgaggacggccagaccatcgagtcgcactcgatctccgccggcctggac
taccccggcgtggggcccgagcacgcgtggctggccgccagcggccgcgcctcctaccac
ccggtcaccgacgcgcaggccatggacgccttccgcctgctgtgccgcaccgaggggatc
atccccgccatcgagagctcccacgccctcgccggggccctcgacctcgggcgcgagctc
ggccccgacgcggtgatcctcgtcagcctgtccgggcgcggggacaaggacgtcgacacc
gccgcccgctggttcgggctggtcagcgacgctgacctcgtcgcctcggaggccgagcgc
gtggccgacgtgcccgagaacaccgaggggtcggggtggtga

DBGET integrated database retrieval system