KEGG   Kineococcus radiotolerans: Krad_3161Help
Entry
Krad_3161         CDS       T00562                                 

Definition
(GenBank) N-acetyl-gamma-glutamyl-phosphate reductase
  KO
K00145  N-acetyl-gamma-glutamyl-phosphate reductase [EC:1.2.1.38]
Organism
kra  Kineococcus radiotolerans
Pathway
kra00220  Arginine biosynthesis
kra01100  Metabolic pathways
kra01110  Biosynthesis of secondary metabolites
kra01130  Biosynthesis of antibiotics
kra01210  2-Oxocarboxylic acid metabolism
kra01230  Biosynthesis of amino acids
Module
kra_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:kra00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    Krad_3161
Enzymes [BR:kra01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.38  N-acetyl-gamma-glutamyl-phosphate reductase
     Krad_3161
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Semialdhyde_dh Semialdhyde_dhC Phage_holin_3_3 F420_oxidored NAD_binding_10
Motif
Other DBs
NCBI-ProteinID: ABS04625
UniProt: A6WCT6
Position
3830367..3831461
Genome map
AA seq 364 aa AA seqDB search
MHAYPAACMVMHMEPGKRLSVAVAGASGYAGGEVLRVLLDHPHVEIGALTGASNAGTPLG
ALQPHLPPLADRVLQPTTTEVLAGHDVVFLALPHGASAEVAAELGDDVLVVDLGADHRLT
DPARWAEFYGGTHAGTWPYGLPELPLAGGGTQRENLVGTRRIAVPGCYPTAVSLALAPGL
AAGLLEPADVVVVAASGTSGAGKSLKPHLLGAEVMGSMSPYGVGGGHRHTPEIEQNLALS
AGVPVQVSFTPTLAPMSRGILATCTARLAPGAAAGDVRAAWERAYAAEPFVHLLPEGRWP
STASVLGGNSCAMQLAVDERAGRVLVVAAIDNLVKGTAGGAVQSVNIALGLPEGTGLTAA
GVAP
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgcatgcctacccagcggcgtgtatggtcatgcacatggaaccggggaagcggctgtcg
gtcgccgtcgcaggagccagcggctacgccggcggcgaggtcctgcgcgtgctgctggac
cacccgcacgtcgagatcggcgccctcaccggcgcctccaacgcgggaacccccctcggc
gccctgcagccgcacctgccgccgctggccgaccgcgtcctgcagcccaccaccaccgag
gtcctcgccggccacgacgtcgtcttcctcgccctgccgcacggcgcctcggccgaggtc
gccgccgagctcggggacgacgtcctcgtcgtcgacctcggcgccgaccaccgcctcacc
gaccccgcccgctgggcggagttctacggcggcacccacgccgggacctggccctacggc
ctgcccgagctgccgctcgccgggggcgggacccagcgggagaacctcgtcggcacccgc
cgcatcgcggtccccgggtgctacccgaccgcggtcagcctggccctggccccgggtctg
gccgccggcctgctggaacccgccgacgtggtcgtcgtggccgcctcggggacctccggg
gccggcaagagcctcaagccgcacctgctgggggcagaggtcatgggctcgatgagcccc
tacggcgtcggcggcgggcaccgtcacacccccgagatcgagcagaacctcgccctgtcc
gcgggggtgcccgtgcaggtgtccttcacccccaccctggccccgatgtcccgcgggatc
ctggccacctgcaccgcccggctcgcccccggcgccgccgccggcgacgtgcgggccgcc
tgggaacgggcctacgccgccgaacccttcgtgcacctgctccccgaggggcggtggccg
tccacggcgtcggtcctggggggcaactcgtgcgcgatgcagctcgccgtcgacgagcgc
gccggccgcgtcctcgtcgtcgccgccatcgacaacctcgtcaagggaaccgccggagga
gccgtgcaatcggtgaacatcgccctcggactgccggagggcaccgggctgaccgccgcg
ggggtcgccccgtga

DBGET integrated database retrieval system