KEGG   Kineococcus radiotolerans: Krad_3171Help
Entry
Krad_3171         CDS       T00562                                 

Definition
(GenBank) DoxX family protein
  KO
K15977  putative oxidoreductase
Organism
kra  Kineococcus radiotolerans
Brite
KEGG Orthology (KO) [BR:kra00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99999 Others
    Krad_3171
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DoxX
Motif
Other DBs
NCBI-ProteinID: ABS04635
UniProt: A6WCU6
Position
complement(3820706..3821269)
Genome map
AA seq 187 aa AA seqDB search
MSSNDLSLLALRLGVGGTLVAHGAQKLFGAFGGGGIEGTAGAMHAMGFRPGKRNAVLAGA
SEAGGGALLVLGLATPVGGASAAAAMVAAAFVHKPNGFFTTSGGFEYPAVLGLVSAALAV
SGPGRFSLDAATGHALNKRWTTVLALAGAGAGAYATIKQRQATVAADAQAQEAADAPADG
PGTPVAS
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
gtgagctcgaacgacctcagcctgctcgccctgcgactcggcgtcggcgggacgctggtc
gcccacggcgcccagaagctcttcggcgccttcggcggcggcggcatcgaaggcaccgcc
ggcgccatgcacgccatgggcttccgccccggcaagcgcaacgccgtgctggccggcgcc
agcgaggccggtggcggggcgctgctcgtcctcggcctggccacccccgtcgggggcgcc
tccgccgcggccgccatggtggccgccgccttcgtgcacaagccgaacggcttcttcacc
acctccggcggcttcgagtaccccgccgtcctgggcctggtgtccgccgcgctggccgtg
agcggccccggccgcttcagcctggacgccgccacgggccacgcgctcaacaagcgctgg
acgacggtgctggcgctcgccggcgccggggccggcgcctacgccaccatcaagcagcgc
caggcgaccgtcgccgcggacgcgcaggcccaggaagcggccgacgcccccgccgacggc
cccgggacgcccgtcgcctcctga

DBGET integrated database retrieval system