KEGG   Kineococcus radiotolerans: Krad_3175Help
Entry
Krad_3175         CDS       T00562                                 

Definition
(GenBank) Imidazoleglycerol-phosphate dehydratase
  KO
K01693  imidazoleglycerol-phosphate dehydratase [EC:4.2.1.19]
Organism
kra  Kineococcus radiotolerans
Pathway
kra00340  Histidine metabolism
kra01100  Metabolic pathways
kra01110  Biosynthesis of secondary metabolites
kra01230  Biosynthesis of amino acids
Module
kra_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:kra00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    Krad_3175
Enzymes [BR:kra01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.19  imidazoleglycerol-phosphate dehydratase
     Krad_3175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPD GlnD_UR_UTase
Motif
Other DBs
NCBI-ProteinID: ABS04639
UniProt: A6WCV0
Position
3817839..3818438
Genome map
AA seq 199 aa AA seqDB search
MSRTARIERSTSESSVLVELDLDGTGRTSIDTTVPFYDHMLTALGKHSLMDLTVVAKGDT
HIDVHHTVEDTAIVLGQAFRQALGDKAGIRRFADATVPLDEALAHVVVDVSGRPYCVHTG
EPEGQEYHLIGGHFTGSLTRHLLESFAFHARIALHVRVLAGRDPHHVVEAQFKALARALR
YAVEPDPRVQGIPSTKGAL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgcacggcgcgcatcgagcgcagcaccagcgagtccagcgtcctcgtcgagctc
gacctcgacggcacggggaggacgagcatcgacaccacggtgccgttctacgaccacatg
ctcaccgcgctgggcaagcactcgctgatggacctcacggtggtcgccaagggcgacacc
cacatcgacgtccaccacaccgtcgaggacaccgccatcgtgctggggcaggcgttccgc
caggccctgggcgacaaggccggcatccgccgcttcgccgacgccaccgtcccactcgac
gaggccctcgcccacgtcgtcgtcgacgtctccggccgtccctactgcgtgcacaccggc
gaaccggaggggcaggagtaccacctcatcggcggccacttcaccgggtccctgacccgg
cacctgctggagagcttcgccttccacgcccggatcgcgctgcacgtgcgcgtcctcgcc
ggccgcgacccgcaccacgtcgtggaggcgcagttcaaggcgctggcccgggcgctgcgc
tacgcggtggaaccggacccgcgcgtccaggggatcccctccacgaagggtgcgctgtga

DBGET integrated database retrieval system