KEGG   Kineococcus radiotolerans: Krad_3180Help
Entry
Krad_3180         CDS       T00562                                 

Definition
(GenBank) hypothetical protein
Organism
kra  Kineococcus radiotolerans
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABS04644
UniProt: A6WCV5
Position
3813571..3814107
Genome map
AA seq 178 aa AA seqDB search
MSEQVPGGDPDFDFDAEFEKAFGPKPPVRSVLVVPVANARKLAEVCTAAGVNAFVVPVKG
LGCVLVTEDPATGEADAGTLSRLLQGAEVVLLTVGEDSIEGQTWAGGRRGEDPRPGLLLS
VWPDVVQQLVLGRLDPAEAAGAAAGGDGSRIGAFWKLFRSRSEDGPTAPGAGDPDGPR
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgagcaggtgcccggcggggacccggacttcgacttcgacgccgagttcgagaag
gcgttcggccccaagccgccggtgcgttccgtcctcgtggtcccggtggccaacgcgagg
aagctcgccgaggtgtgcaccgcggcgggggtcaacgcgttcgtggtgccggtgaagggc
ctcgggtgcgtcctggtcaccgaggacccggcgacgggggaggcggacgcagggacgctc
tcgcgcctgctccagggggccgaggtcgtcctgctgaccgtgggggaggactccatcgaa
gggcagacctgggcgggcggccggcgcggggaggacccgcgcccgggtctgctgctgtcg
gtgtggcccgacgtggtgcagcagctggtgctggggcgcctggaccccgccgaggccgcc
ggcgcggcggccggcggggatggcagccgcatcggcgcgttctggaagctgttccggagc
cggagcgaggacgggcccaccgccccgggggccggcgaccccgacgggccgcgctga

DBGET integrated database retrieval system