KEGG   Kineococcus radiotolerans: Krad_3186Help
Entry
Krad_3186         CDS       T00562                                 

Definition
(GenBank) hypothetical protein
Organism
kra  Kineococcus radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl_transf_3 DUF4131
Motif
Other DBs
NCBI-ProteinID: ABS04650
UniProt: A6WCW1
Position
3808892..3809380
Genome map
AA seq 162 aa AA seqDB search
MPGVTAAPVPGPGRTDRLPLVLLFGQALLGLVVGVVWWALTRHPPTWVVGEPVVTSPAVY
PVARDGVFTVLTGLLGVLAGLAVVRAPGPRPLLLLGAALAGAAAGALLAAGLGTSLPPTD
PADSAHVTLHAWVVLLVQPFVVAVVVALVTLTRSLLEWTRVP
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
gtgcctggtgtgacggccgccccggtcccggggcccgggcggacggaccggctgccgctg
gtcctgctcttcggccaggccctgctgggcctggtcgtgggggtcgtgtggtgggcgctc
acccgccaccccccgacctgggtggtgggcgaaccggtcgtcacctcgcccgcggtgtac
cccgtcgcccgcgacggggtcttcaccgtgctcaccggcctgctcggggtcctcgcgggg
ctcgccgtcgtccgcgccccggggccgaggcccctgctcctgctgggggccgccctggcg
ggggcggcggccggtgcgctgctggccgcggggctgggcacgtccctgccgcccaccgac
cccgccgacagcgcccacgtgacgctgcacgcgtgggtcgtgctgctggtccagccgttc
gtcgtcgccgtcgtcgtcgcgctcgtgacgctcacccggtcgctgctggagtggacgcgc
gtgccctga

DBGET integrated database retrieval system