KEGG   Kineococcus radiotolerans: Krad_3191Help
Entry
Krad_3191         CDS       T00562                                 

Definition
(GenBank) DivIVA family protein
Organism
kra  Kineococcus radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DivIVA DUF3287 DUF5082 DUF2852 Apolipoprotein Neisseria_TspB
Motif
Other DBs
NCBI-ProteinID: ABS04655
UniProt: A6WCW6
Position
3802349..3803026
Genome map
AA seq 225 aa AA seqDB search
MPLTPEDVVEKRFNPTRVREGYAQDEVDDFLDEVVAELRRLNGENAELRGQLSQCQARVA
ELTRAGAQVADAPAPVAEVPEAAEPVVEPVAEEEPPAPEPEPAPVSAPAPQPAAAAGEDA
AVRAAGVIALAQRLHDEYVREGEAQRDALVAAAQEQAQRVVTEAEAQRERTLGELETRRH
VLEDVIHELHGRETTYREQLDRFMASQLEDLRRLARVVPDDAVTR
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgccgctcactccggaagacgtcgtcgagaagcgattcaaccccacgcgcgtgcgcgag
gggtacgcccaggacgaggtcgacgacttcctcgacgaggtcgtcgccgagctgcgccgg
ctcaacggcgagaacgccgagctgcgcggtcagctcagccagtgccaggcccgggtcgcc
gagctgacccgggcgggcgcccaggtcgcggacgcgcccgccccggtcgccgaggtcccc
gaggccgccgagccggtcgtcgaacccgtggccgaggaggaacccccggcccccgagccg
gagccggcgccggtgagcgcgcccgctccccagcccgccgctgcggcgggggaggacgcg
gccgtgcgcgccgccggggtcatcgccctggcgcagcgcctgcacgacgagtacgtccgc
gagggtgaggcgcagcgcgacgcgctcgtcgccgcggcccaggagcaggcccagcgcgta
gtgaccgaggcggaggcgcagcgcgagcgcacgctgggcgagctggagacccgccggcac
gtcctcgaggacgtcatccacgagctgcacggccgtgagaccacctaccgcgagcagctc
gaccgcttcatggcctcccagctcgaggacctgcgccgcctggcccgcgtcgtccccgac
gacgccgtgacccgctag

DBGET integrated database retrieval system