KEGG   Kineococcus radiotolerans: Krad_3193Help
Entry
Krad_3193         CDS       T00562                                 

Definition
(GenBank) protein of unknown function DUF552
  KO
K09772  cell division inhibitor SepF
Organism
kra  Kineococcus radiotolerans
Brite
Chromosome and associated proteins [BR:kra03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Inhibitors of FtsZ assembly
    Krad_3193
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SepF Trypan_PARP
Motif
Other DBs
NCBI-ProteinID: ABS04657
UniProt: A6WCW8
Position
3801333..3801896
Genome map
AA seq 187 aa AA seqDB search
MAGALRNAMVYLGLAEDDRYAEDTEPETTRPRVEAAREVRVESRHEARPEVRHEPRPEVS
VERRPAPATTAQVTPIRKQVAHVVPQTSTTSSSPELHRITTIHPRTYNEAKTIGESFREG
VPVIMNLTDMDDSDAKRLVDFSAGLVFGLHGAIERVTNKVFLLSPANVEVASQEEERPTE
RTFFNQS
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atggccggcgcgctgcgcaatgcgatggtctacctcggcctcgcggaggacgaccgctac
gccgaggacaccgagcccgagacgacgcgcccccgggtcgaggccgcccgcgaggtgcgc
gtcgagtcccggcacgaggcgcgccccgaggtccggcacgaaccccggccggaggtgtcc
gtcgagcgtcggcccgctcccgcgaccaccgcccaggtgaccccgatcaggaagcaggtg
gcccacgtggttccccagacgtcgaccacctcctcgtcccccgagctgcaccggatcacg
acgatccacccgcggacctacaacgaggccaagaccatcggcgagtcgttccgcgagggc
gtcccggtgatcatgaacctgacggacatggacgactccgacgccaagcggctggtggac
ttctccgccggtctggtcttcgggctgcacggtgcgatcgagcgggtgaccaacaaggtc
ttcctgctctcgccggcgaacgtggaggtcgcctcccaggaggaggagcgtccgaccgag
cgaaccttcttcaaccagtcctga

DBGET integrated database retrieval system