KEGG   Kineococcus radiotolerans: Krad_3195Help
Entry
Krad_3195         CDS       T00562                                 

Definition
(GenBank) protein of unknown function DUF152
  KO
K05810  polyphenol oxidase [EC:1.10.3.-]
Organism
kra  Kineococcus radiotolerans
Brite
Enzymes [BR:kra01000]
 1. Oxidoreductases
  1.10  Acting on diphenols and related substances as donors
   1.10.3  With oxygen as acceptor
    1.10.3.-  
     Krad_3195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cu-oxidase_4
Motif
Other DBs
NCBI-ProteinID: ABS04659
UniProt: A6WCX0
Position
3799825..3800550
Genome map
AA seq 241 aa AA seqDB search
MPDERVPLLDAGLPAGVRGGFTTRAGGRGPAPYDGLNLGDHVGDDPARVAAHREALRAAV
GAEHLVVGEQVHGADVVEVHGPPAVVPRADALITAVPGLALAVVVADCVPVLLADPRAGL
VAVAHAGRPGLVAGVVPAVVAALRARGAQDLVAVLGPSVCGGCYEVPQAMSDEVAARVPA
ARARTRRGTPAVDVAAGVLAQLERLAVPASRVERCTVEDDDLFSYRREGRTGRSGGVVVL
A
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgacgagcgcgtcccgctgttggacgccggcctcccggccggcgtccgcggcggg
ttcaccacccgggccggtggccgcggtccggccccgtacgacggcctgaacctcggtgac
cacgtcggcgacgaccccgcccgggtcgcggcgcaccgcgaggcgctgcgcgccgccgtg
ggggccgagcacctggtcgtgggcgagcaggtgcacggcgccgacgtcgtcgaggtccac
ggcccgccggcggtcgtcccgcgcgccgacgccctgatcaccgccgtccccgggctggcc
ctcgccgtcgtggtcgccgactgcgtccccgtgctgctggccgacccgcgcgcgggcctg
gtcgcggtggcccacgccggccgtccgggtctcgtggcgggtgtcgtccccgccgtggtc
gcggcgctgcgcgcccgcggcgcgcaggacctcgtcgcggtcctcggcccctccgtctgc
gggggctgctacgaggtgccgcaggcgatgtccgacgaggtcgccgcccgggtccccgcg
gcccgggcccggacgcgccggggcaccccggccgtcgacgtggcggccggggtcctcgcg
cagctggagcggctcgccgtccccgcctcccgcgtggagcgctgcaccgtcgaggacgac
gacctcttctcctaccgccgcgagggccggaccgggcgcagcgggggcgtggtggtgctg
gcgtga

DBGET integrated database retrieval system