KEGG   Kineococcus radiotolerans: Krad_3200Help
Entry
Krad_3200         CDS       T00562                                 

Definition
(GenBank) cell division protein FtsW
  KO
K03588  cell division protein FtsW
Organism
kra  Kineococcus radiotolerans
Brite
KEGG Orthology (KO) [BR:kra00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:kra03036]
    Krad_3200
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kra02000]
    Krad_3200
Chromosome and associated proteins [BR:kra03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    Krad_3200
Transporters [BR:kra02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   Krad_3200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTSW_RODA_SPOVE
Motif
Other DBs
NCBI-ProteinID: ABS04664
UniProt: A6WCX5
Position
3793340..3794671
Genome map
AA seq 443 aa AA seqDB search
MALTGSRERPTTRPRASAPDWRRPAWLDATGEWFRDRVRLLESPLATHHVLLGTTAMLVV
IGLVMVLSSSSVEALTEYGTPYYFFRKQAIFAVLGAVVLLVASRVPARAWQRLALPALFA
TAFLQLLVFVPGIGKEVGGNRNWIQVGGFQAQPSEAAKIALVLALALALSRRQEVLHEPA
KLAAAMVPSVGLTIGLVLLSRDLGTALIMMAVVVVMLWVAGIPARWFALAGGIGGLVAAL
AVLSSTNRRHRVQDWLSGSTDSAQAIQGLSWQPVQGKYALASGGWWGLGLGASREKWSWL
PEAHNDFIFAIIGEELGLPGTLTILVLFGVLALATLRLVRRSQTLYAKLAVAGFAAWILG
QAGLNIAVVLSLLPVIGVPLPLISYGGSALVLTLLGVGVLLSFARAEPGAPEAIRARESV
VARSLAVLPQRTPKRTRPTRGSK
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
gtggcgctgaccggttcgcgcgaacggcccaccacccgcccccgggcgagcgcccccgac
tggcgccgcccggcgtggctggacgcgacgggggagtggttccgcgaccgcgtgcggctg
ctggagtccccgctggccacccaccacgtcctgctcggcaccacggccatgctcgtggtg
atcgggctggtcatggtgctgtcgagctccagcgtggaggcgctcaccgagtacgggacg
ccctactacttcttccgcaagcaggccatcttcgccgtcctgggcgcggtcgtgctcctc
gtcgccagccgcgtcccggcgcgcgcctggcagcggctggccctgcccgcgctgttcgcc
acggccttcctgcagctgctcgtcttcgtgcccggcatcggcaaggaggtcggcggcaac
cggaactggatccaggtcggcggcttccaggcccagccgtcggaggccgcgaagatcgcg
ctggtgctggcgctggcgctggcgctgtcgcgccggcaggaggtgctgcacgagccggcg
aagctcgccgccgcgatggtcccctcggtcgggctgacgatcggcctggtgctgctctcc
cgcgacctggggaccgcgctgatcatgatggccgtcgtggtcgtgatgctgtgggtcgcc
ggcatccccgcccggtggttcgccctggcgggcggcatcggcggcctggtggccgcgctg
gccgtcctgagcagcaccaaccgccggcaccgcgtgcaggactggctctccggcagcacc
gacagcgcccaggccatccagggcctgtcctggcagccggtccaggggaagtacgcgctg
gcctcgggcggctggtggggcctgggcctcggggccagccgggagaagtggtcctggctg
ccggaggcgcacaacgacttcatcttcgcgatcatcggcgaggagctgggcctgcccggg
acgctgaccatcctcgtgctcttcggcgtgctggccctggccaccctgcgcctggtccgg
cgctcgcagaccctctacgccaagctcgccgtggccgggttcgcggcctggatcctgggt
caggcgggcctcaacatcgccgtcgtcctgagcctgctcccggtcatcggcgtccccctg
ccgctcatctcctacggggggtccgcgctcgtgctgaccctgctgggcgtgggcgtcctg
ctgtccttcgcccgcgccgagcccggcgcccccgaggccatccgggcccgggagtcggtc
gtcgcccggtccctggcggtgctgccgcaacgcacccccaagcgcacgcgtcccacgaga
ggctcgaagtga

DBGET integrated database retrieval system