KEGG   Kineococcus radiotolerans: Krad_3202Help
Entry
Krad_3202         CDS       T00562                                 

Definition
(GenBank) phospho-N-acetylmuramoyl-pentapeptide-transferase
  KO
K01000  phospho-N-acetylmuramoyl-pentapeptide-transferase [EC:2.7.8.13]
Organism
kra  Kineococcus radiotolerans
Pathway
kra00550  Peptidoglycan biosynthesis
kra01100  Metabolic pathways
kra01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:kra00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Krad_3202
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    Krad_3202
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:kra01011]
    Krad_3202
Enzymes [BR:kra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.13  phospho-N-acetylmuramoyl-pentapeptide-transferase
     Krad_3202
Peptidoglycan biosynthesis and degradation proteins [BR:kra01011]
 Precursor biosynthesis
  Glycosyltransferase
   Krad_3202
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_4 MraY_sig1
Motif
Other DBs
NCBI-ProteinID: ABS04666
UniProt: A6WCX7
Position
3790664..3791755
Genome map
AA seq 363 aa AA seqDB search
MRTVLIAGAFSLVVSLFGTPLYIRWLVRRGYGQFVRDDGPTSHHTKRGTPTMGGVVIILA
ALLAYGAAHLFTGALPTVSGLLVLLLMTGLGVVGFLDDFLKISNQRSLGLTAKAKLAGQG
LVGIVFAVLALQFPAAGKDGTTPASTHISVLRDTPLDLAVFGAVGGTVLFVVWALIITSA
VSNGVNLTDGLDGLATGATTMVLAAYVLICTFQSNQSCYSLTEVEARCYEVRDPRDLAVV
AAAVMGACFGFLWWNASPAKIFMGDTGSLALGGALAGLAILSRTQILLVLLGGLFVLITL
SVILQVGSFKLTGKRIFRMAPLQHHFELAGWGEVTIVIRFWIIAGLFVFLGLGVFYAEWV
TGA
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
gtgaggaccgtcctcatcgcgggagcgttctccctcgtcgtctccctcttcgggaccccg
ctctacatccgctggctcgtgcgccgcgggtacgggcagttcgtccgcgacgacgggccg
acctcgcaccacaccaagcgcggcacccccacgatgggcggggtcgtcatcatcctcgcc
gccctgctggcctacggcgccgcgcacctgttcaccggggcgctgcccacggtctcgggc
ctgctcgtgctgctgctgatgaccgggctgggggtcgtgggcttcctcgacgacttcctg
aagatctccaaccagcgcagcctcgggctgaccgccaaggcgaagctcgccgggcagggc
ctggtcgggatcgtcttcgccgtcctcgcgctgcagttcccggccgccggcaaggacggc
accacccccgcctccacgcacatctcggtgctgcgcgacacccccctggacctcgcggtc
ttcggggcggtcggcggcaccgtcctgttcgtggtgtgggcgctgatcatcacctccgcg
gtgagcaacggcgtcaacctcaccgacggcctggacgggctggcgacgggggcgacgacg
atggtcctggccgcctacgtcctcatctgcaccttccagtccaaccagagctgctactcc
ctcaccgaggtcgaggcgcgctgctacgaggtgcgcgacccccgcgacctcgccgtcgtc
gcggccgcggtgatgggcgcctgcttcgggttcctctggtggaacgccagccccgcgaag
atcttcatgggcgacaccggctcgctggccctgggcggtgcgctggccgggctggcgatc
ctgtcccgcacccagatcctgctcgtcctgctcggcgggctcttcgtcctcatcaccctc
tcggtgatcctgcaggtcgggtcgttcaagctgacggggaagcggatcttccggatggcg
ccgttgcagcaccacttcgagctggcgggctggggcgaggtcaccatcgtcatccggttc
tggatcatcgccgggctgttcgtcttcctcggcctcggggtgttctacgcggagtgggtg
accggcgcgtga

DBGET integrated database retrieval system