KEGG   Kineococcus radiotolerans: Krad_3205Help
Entry
Krad_3205         CDS       T00562                                 

Definition
(GenBank) Peptidoglycan glycosyltransferase
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
kra  Kineococcus radiotolerans
Pathway
kra00550  Peptidoglycan biosynthesis
kra01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:kra00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Krad_3205
 09160 Human Diseases
  09168 Drug resistance
   01501 beta-Lactam resistance
    Krad_3205
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:kra01011]
    Krad_3205
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:kra03036]
    Krad_3205
Enzymes [BR:kra01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Krad_3205
Peptidoglycan biosynthesis and degradation proteins [BR:kra01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   Krad_3205
Chromosome and associated proteins [BR:kra03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    Krad_3205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: ABS04669
UniProt: A6WCY0
Position
3785571..3787478
Genome map
AA seq 635 aa AA seqDB search
MSPLRRNRPHARDDGAPTADMRMRVYSVGVLLGLTVLGGRLVQLQGADAGALAERALRQR
TSETKLYAKRGDVVDAKGVVLATSVERRDVIADPQTVQAYNTRPGDGSKYQEEHGQGPAG
AAARLAPVLGIDEATLTDKLTVKATSPRYAVVAVGITPELWQQVADVGISGITSKRQTQR
IYPTGSASSTLVGVLGTPVYDEEAKAYHDYPLGGLESAEDDLLTGTDGSMKYERSLGGQE
IPLGDSEMVEPVDGTSLHLTIDSDLQWKAQSAIAAKVAETGAKSGTVVIMDRRQRLLALA
SAPSIDPTNLTDFTNDQLLNTALTEAFEPGSTAKVVTLAAVLEEGRATASSPFTVPYALQ
RSDKLFHDSHEHPEEKLTLAGILAQSSNTGTILAGEQLDARTLYEYQRAFGFGSRTTLSF
PGETAGIVAKPEDYSGTQRYTVMFGQGLSVNAVQAASVFATIANDGVRVEPTLIAGTSDP
NGNRTTAPAGDSARVVSSETAKTLRDMMQAVVSEEGTAAAAEIPGYLVAGKTGTAERYDE
DLGRYSGYTASFIGLAPADDPELVVAVILQDPRTNYYGGSAAGPVFKEVMTYALAQRGVA
PSAEPPANLPLTWGGEAEAGAARAPGAAGDAAGAQ
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
gtgtccccactgcgccgcaaccgaccccacgcccgcgacgacggggcgccgaccgcggac
atgaggatgcgcgtctacagcgtgggggtcctgctcggcctgaccgtcctcggggggcgg
ctggtccagctccagggcgccgacgccggggccctggccgaacgcgctctgcggcaacgc
acctcggagaccaagctgtacgccaagcgcggcgacgtcgtcgacgccaagggcgtcgtg
ctggcgacgtcggtcgagcggcgcgacgtcatcgccgacccgcagaccgtccaggcgtac
aacacccgtcccggcgacgggtcgaagtaccaggaggagcacgggcagggcccggccggc
gcggcggcgcggctggcccccgtgctcgggatcgacgaggcgaccctcaccgacaagctg
accgtgaaggcgacgagcccgcgctacgccgtcgtggcggtcggcatcaccccggagctg
tggcagcaggtcgccgacgtcggcatcagcgggatcacctccaagcgccagacccagcgc
atctacccgacggggtcggcgtcctccaccctcgtcggcgtcctgggcacccccgtctac
gacgaggaggcgaaggcgtaccacgactaccccctcggcgggctggagtcggccgaggac
gacctgctgacgggcaccgacgggtcgatgaagtacgagcgcagcctcggcggccaggag
atcccgctgggcgacagcgagatggtcgagcccgtcgacggcacctccctgcacctgacg
atcgactcggacctgcagtggaaggcgcagtcggcgatcgcggccaaggtcgccgagacg
ggcgcgaagtccggcaccgtcgtgatcatggacaggcggcagcggctgctcgcgctggcc
agcgcgcccagcatcgaccccacgaacctcacggacttcaccaacgaccagctcctgaac
accgcgctcaccgaggccttcgaacccggctcgacggccaaggtcgtgacgctggcggcg
gtgctggaggaggggagggccacggcctccagccccttcaccgtcccctacgcgctgcag
aggtcggacaagctcttccacgactcccacgagcaccccgaggagaagctcacgctggcg
gggatcctcgcccagtccagcaacaccggaaccatcctggccggggagcagctcgacgcg
cggacgctgtacgagtaccagcgcgccttcgggttcggcagccggaccacgctctccttc
cccggggagaccgccggcatcgtggcgaagcccgaggactactccgggacccagcgctac
accgtgatgttcgggcagggactctccgtcaacgccgtgcaggcggcctcggtgttcgcc
accatcgccaacgacggcgtgcgcgtcgagcccacgctcatcgccgggacgtcggacccg
aacggcaaccgcaccaccgcccccgccggcgactccgcccgggtggtgagttccgagacc
gcgaagacgttgcgggacatgatgcaagccgtcgtcagcgaggaggggaccgccgccgcc
gcggagatcccgggttacctcgtcgccggcaagaccggcaccgcggaacgctacgacgag
gacctcggccgctactccggttacaccgcgtcgttcatcgggctggcccccgccgacgac
ccggaactggtggtggccgtgatcctgcaggacccccggacgaactactacggcgggtcg
gccgcgggtccggtgttcaaggaggtcatgacctacgcgctcgcgcagcgcggggtcgcc
ccctccgccgaacccccggcgaacctcccgctcacctgggggggcgaggccgaggccggg
gccgcgcgcgccccgggcgccgccggggacgccgcgggagcgcagtga

DBGET integrated database retrieval system