KEGG   Kineococcus radiotolerans: Krad_3217Help
Entry
Krad_3217         CDS       T00562                                 

Definition
(GenBank) hypothetical protein
Organism
kra  Kineococcus radiotolerans
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABS04681
UniProt: A6WCZ2
Position
3770414..3770821
Genome map
AA seq 135 aa AA seqDB search
MRRFSDEVHVRCGARGEEAGVPALFVWRGRLYVVREVLSRWRERSAWWEHAAVAAVHGDE
AGGAGGAVTAVRPVLEIGDLEREVFRVEAGVGRAGAVGVYDLARPVALGTAAVSEVAGNP
VLDEPREWQLLRVSD
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
gtgcggcggttctccgacgaggtccacgtgcggtgcggcgcgaggggggaggaggccggt
gtcccggccctgttcgtctggcgcggccggctctacgtggtgcgcgaggtcctgtcccgg
tggcgcgagcgcagcgcgtggtgggagcacgccgccgtcgccgccgtccacggcgacgag
gcgggcggggcggggggcgcggtgacggcggtgcggccggtgctcgagatcggggacctc
gagcgggaggtcttccgcgtcgaggccggggtggggcgggccggcgcggtgggcgtctac
gacctcgcccgtccggtggccctcgggacggcggccgtgtcggaggtcgctggtaatcct
gttctcgacgaaccgcgcgagtggcagttgctgcgcgtcagcgactga

DBGET integrated database retrieval system