KEGG   Kineococcus radiotolerans: Krad_3218Help
Entry
Krad_3218         CDS       T00562                                 

Definition
(GenBank) hypothetical protein
Organism
kra  Kineococcus radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DEC-1_N
Motif
Other DBs
NCBI-ProteinID: ABS04682
UniProt: A6WCZ3
Position
complement(3769445..3770158)
Genome map
AA seq 237 aa AA seqDB search
MTPGGAVTRTADGLSTATSRRRPRRAAACDRATVIPLHRVAAPLVALLAVGALAGCSQEA
ADAPVVGSAPAGAVTATPTTPAASPAGATPTPVTTRSLPLPEQTELSRTFTVDGASAFAA
YFTQVLNYANGTGDPALLLSISDAGCSGCRYQADVIDEYRARGYSSTGFEIQFTGTRVDS
WDAAKGEIGLTVSTTKTAFETTDLHGRVVGSAPSVPNGEFWLDLNWSDGRWIVWEVE
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
gtgacccccgggggcgccgtcacccggacggccgacgggttgtccacagcgacctcccga
cggcgcccgcgccgcgccgcggcgtgcgaccgtgccacggtgatcccgctccaccgcgtc
gccgcacccctcgtcgcgctcctcgccgtcggcgcgctcgccgggtgttcgcaggaggcg
gcggacgcgccagtggtgggttccgccccggccggcgccgtcacggccaccccgacgaca
ccggcggcctcaccggccggcgcgacccccaccccggtgaccacgaggagcctcccgctg
cccgagcagaccgagctgagccggacgttcacggtggacggagccagcgcgttcgcggcc
tacttcacgcaggtcctgaactacgccaatggaacgggggaccccgctctcctcctgtcc
atctcggacgcaggctgctccggatgccggtaccaggctgatgtgatcgacgagtatcga
gcgcggggctactcctcgaccgggttcgagatccagttcactggcacccgggtcgactcg
tgggatgcagcgaaaggcgagatcggcctcactgtgtcaacgaccaagacggccttcgag
acaaccgacctccacggtcgagtcgtcggctccgcgccgtcagtcccgaacggtgagttc
tggctcgatctcaactggtcagatgggcgctggatcgtctgggaggtggaatga

DBGET integrated database retrieval system