KEGG   Kineococcus radiotolerans: Krad_3219Help
Entry
Krad_3219         CDS       T00562                                 

Definition
(GenBank) hypothetical protein
Organism
kra  Kineococcus radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PKD
Motif
Other DBs
NCBI-ProteinID: ABS04683
UniProt: A6WCZ4
Position
complement(3768612..3769448)
Genome map
AA seq 278 aa AA seqDB search
MRSWKTAWGVSTTICVLTLACASSTAWAGPTGSTGISRDDSFEIGASRSDSQRQHRNPSR
DSARQGPPVEVVRTPACGRNGPEGSFGDDFCGASNRLCPPGQTFATTWTRTGGAPWVNGG
SRCTAGAEDAEPVTLPVVTEADLRRLPLPAGAVELQPRTGLALLHVPLVLRTGTDVVVRD
TTVLGYPVTVRATPTSWTWDLGDGTTLGPTTDPGNPYPRATLTHAYDTPGEHLITLTTTY
TGEYTVAGLPYRPVAGTATVVSAATAVQVREGSAVLTR
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgaggagctggaagaccgcctggggtgtcagcacgacgatctgcgtgctgaccctggcc
tgcgccagctcgactgcctgggcgggccccacggggtcaacgggaatcagccgcgacgac
agtttcgagatcggcgcatcgcgttccgattcccagcgccagcaccggaatcccagccgg
gactctgctcgtcaaggcccacccgtggaggtcgtcaggacccccgcctgcggtcgcaac
ggccccgagggttccttcggcgacgacttctgcggcgcctcgaaccgcctctgcccgccg
ggccagaccttcgccacgacctggacccggaccgggggcgccccctgggtcaacgggggc
agcaggtgcaccgcgggggcggaggacgcggaacctgtcaccctgcccgtcgtcaccgag
gccgacctgcgccgcctcccgctgcccgccggcgccgtggagctgcagccccgcaccggc
ctggccctgctgcacgtgccgctcgtcctgcgcaccgggaccgacgtcgtcgtgcgcgac
acgacggtcctcggctacccggtgacggtccgcgccacgccgaccagctggacgtgggac
ctcggggacggcaccaccctgggccccaccaccgaccccgggaacccgtacccgcgggcg
accctgacccacgcctacgacacccccggcgagcacctgatcaccctcaccacgacgtac
accggcgagtacaccgtcgccgggctcccgtaccgccccgtcgcgggcaccgccaccgtc
gtctccgcggccaccgcggtgcaggtccgcgaggggtccgccgtcctcacccgctga

DBGET integrated database retrieval system