KEGG   Kineococcus radiotolerans: Krad_3222Help
Entry
Krad_3222         CDS       T00562                                 

Definition
(GenBank) conserved hypothetical protein
Organism
kra  Kineococcus radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3291
Motif
Other DBs
NCBI-ProteinID: ABS04686
UniProt: A6WCZ7
Position
complement(3766480..3767184)
Genome map
AA seq 234 aa AA seqDB search
MPATPEVVTLDVWTVTPRAVPRAVWRMAADRRAVQRLPGAQFGKLLGTGDGTTFTVRDAD
PRHWAVLVAWDRLADAERYETSRPVRAWQRFATERLQVRLAPHGSRGRWSGREPFGPPRA
RGGADVEGPIASITRARLHPSRAAGFWRAVPPVAAELRTVPGLRCAMGIGEAPLGYQGTF
SLWDSTGALEEFAHRREAHRNVMARTPREGWYVEELFARFRVLDVRGTLDGRTP
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgccacccccgaggtcgtgaccctcgacgtctggaccgtcaccccgcgagccgtc
ccccgcgccgtgtggcgcatggccgcggaccgccgcgcggtgcagcggctgccgggggcg
cagttcgggaagctgctgggcaccggggacgggacgacgttcaccgtccgcgacgccgac
ccgcggcactgggccgtcctcgtcgcctgggaccgcctcgccgacgccgagcgctacgag
acctcccgcccggtgcgcgcctggcagcggttcgccaccgagcgcctgcaggtccggctc
gcgccccacggcagccgcggccgctggtccgggcgcgagcccttcggcccgccccgcgcg
cggggcggcgcggacgtggagggccccatcgcctccatcacccgcgcccggctgcacccg
agccgcgccgccgggttctggcgggcggtgccgccggtggccgccgagctgcgcaccgtg
cccgggctgcggtgcgcgatggggatcggggaggcgccgctgggctaccaggggacgttc
tcgctgtgggactccaccggcgccctggaggagttcgcccaccgccgcgaggcccaccgc
aacgtcatggcccgcaccccgcgggagggctggtacgtggaggagctgttcgcccggttc
cgggtcctggacgtccgggggacgctggacgggcgcaccccctga

DBGET integrated database retrieval system