KEGG   Kineococcus radiotolerans: Krad_3226Help
Entry
Krad_3226         CDS       T00562                                 

Definition
(GenBank) CDP-alcohol phosphatidyltransferase
  KO
K00995  CDP-diacylglycerol---glycerol-3-phosphate 3-phosphatidyltransferase [EC:2.7.8.5]
Organism
kra  Kineococcus radiotolerans
Pathway
kra00564  Glycerophospholipid metabolism
kra01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kra00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Krad_3226
Enzymes [BR:kra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.5  CDP-diacylglycerol---glycerol-3-phosphate 1-phosphatidyltransferase
     Krad_3226
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CDP-OH_P_transf
Motif
Other DBs
NCBI-ProteinID: ABS04690
UniProt: A6WD01
Position
3762347..3763063
Genome map
AA seq 238 aa AA seqDB search
MASGVSPLVTGGSPATEPYRGPVVMDREAYLRRWRALHGGTHANALVRAWLGGAHALARP
LARAAVPPTAITLAGGALAVLAAAVVVAGGRGGAAAVAAGALLALAGIFDNLDGAVAVMT
GRTSRRGALLDAACDRVGDAACAVVLWACGAPAWLVLLAGGTAQLQEYLRARAQGLGVDD
VRIVSVAERPVRLAIAASCAAATAVVVHLDWATLGAGVWAVLGTIGLVQVATAVGRRL
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
gtggcgagcggggtgtccccgctggtcacgggcggatcacccgccaccgagccctaccgt
ggtcccgtggtgatggatcgggaggcgtacctgcggcgctggcgggcgctgcacggcggc
acgcacgccaacgccctggtgcgggcctggctcggcggcgcccacgccctcgcccggccc
ctcgcccgcgccgcggtgccgcccaccgcgatcaccctggccggcggggcgctcgccgtc
ctcgccgccgcggtcgtcgtcgcgggcggacgcggcggggccgccgcggtcgccgccggc
gcgctgctcgccctcgcggggatcttcgacaacctcgacggcgccgtcgcggtgatgacc
gggcggaccagccgccggggggcgctgctggacgccgcctgcgaccgggtcggcgacgcc
gcctgcgccgtcgtcctgtgggcgtgcggggccccggcctggctggtcctcctcgccggc
gggaccgcgcagctgcaggagtacctgcgcgcccgggcccaggggctcggggtcgacgac
gtgcggatcgtctccgtcgccgagcggccggtgcggctggcgatcgcggcgtcgtgcgcc
gcggccaccgcggtcgtcgtccacctggactgggcgaccctgggggccggggtctgggcg
gtcctggggaccatcggcctcgtgcaggtggccaccgcggtgggccgccggctctga

DBGET integrated database retrieval system